Words Containing: K,Y,R,I,E
(In Any Order)
There are 217 words,
450 phrases and
0 abbr's with
K,Y,R,I,E in.
Best Scoring Words With: K,Y,R,I,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
yukkier | 7 | 18 | adjectiveadj | |||||
adjective • Of something highly offensive; causing aversion or disgust. | ||||||||
crickey | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
shrieky | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
rickety | 7 | 16 | adjectiveadj | |||||
adjective satellite • inclined to shake as from weakness or defect • affected with, suffering from, or characteristic of rickets • lacking bodily or muscular strength or vitality | ||||||||
perkily | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a perky manner | ||||||||
yuckier | 7 | 16 | adverb, adjectiveadv, adj | |||||
adjective • Of something highly offensive; causing aversion or disgust. | ||||||||
rickeys | 7 | 16 | nounn | |||||
noun • a mixed drink made of sweetened lime juice and soda water usually with liquor | ||||||||
rickey | 6 | 15 | verb, nounv, n | |||||
noun • a mixed drink made of sweetened lime juice and soda water usually with liquor | ||||||||
yerking | 7 | 15 | verbv | |||||
verb • To stab. • To throw or thrust with a sudden, smart movement; to kick or strike suddenly; to jerk. • To strike or lash with a whip or stick. • To rouse or excite. • To bind or tie with a jerk. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
kyrieWords (36)
yorkshirereykjavikkimberleyskywriterhyperlinkberrylikefairylikeperikaryaskydiverssyruplikeirksomelywalkyriesteriyakistrinketryjerkinglystreakilyivorylikeskybridgeharpylikekryolitesskywriteseuryokiestriweeklyvalkyriessatyrliketinkertoyscreakilyyikkeringflystrikekyriellesreekinglykartikeyahygrodeikricketilykurveying
...View all with 9 letters...
Phrases (6)
like crazygin rickeystrike payrelay linkdirty jokerye whiskyWords (27)
bricklayerfreakishlyeukaryoticpernicketylawyerliketrotskyitekerygmatichyperlinksperikaryalperikaryonskybridgescherrylikeskywritersskywrittentinkertoysperjinketyperjinkityflystrikeshysterickycreakinglydickey-birddickeybirdkarttikeyastrickenlyrebukinglyhygrodeikspokerishlyPhrases (10)
greek deitylady killerkidney fernkidney wortturkey wingalkyd resinriley b kingflorida keyrye whiskeyyukon riverWords (26)
persnicketykeyboardistmerrymakingyastrzemskihyperlinkedkeystrokingbricklayerskaryogamiesbookbinderykeyboardinggimcrackeryalkalimetryfactorylikelickerishlykaryologieskitty-cornerturkey-sizedrheumatickygreyish-pinkshriekinglydickeybirdsfernyticklepyrokinesespyrokinesisbialystokersilky-hairedPhrases (22)
like royaltypolicy makercelery stickwhiskey sourbicycle rackkitty litterchicken yardparity checkdiary keepernew york city
...View all with 11 letters...
Words (33)
hyperkalemiahyperkineticholidaymakerhyperkineseshyperkinesiahyperlinkingflickeringlymerrymakingskaryokinetickeyboardistshyperkinesisdaydreamlikekymographieskremlinologyhydrokineticskyrocketingkaryokineseskaryokinesiskeyboardingspony-trekkingbradykinesiakeystrokingsrevokabilityfairnytickleblackish-greygreyish-blackfernytickleshydraulickedskinny-dipperbreakabilitylocksmitheryquicksilverykeratohyalinPhrases (23)
risky venturealfred kinseypatrick henryliterary workcylinder lockvery much likegrey kingbirdirish whiskeykey signatureslippery dick
...View all with 12 letters...
Words (21)
marketabilityholidaymakersrekeyboardinghyperkinesiaskindheartedlybradykinesiasblackberryingfairnytickleskitty-corneredjawbreakinglyhydrokineticsremarkabilityknickknackerypoikilothermyjiggery-pokeryforeknowinglykinesitherapyprickly-leafedprickly-leavedkeratomycosispsychometrikaPhrases (28)
el iskandriyahbitter hickorythree kings' dayrichard leakeysilky wisteriakillarney ferncylinder blockpiano keyboardnutmeg hickorysiberian husky
...View all with 13 letters...
Words (13)
hyperkeratoticbreathtakinglyhyperkeratosisearthshakinglyheterokaryosisheterokaryoticmegakaryocytichydrokineticalblackberry-lilyblackberryingshuckleberryingyekaterinoslavkinematographyPhrases (39)
veliky novgorodturkey stuffingkyrgyz republicdynamic speakersouth yorkshirehenry kissingerbishop berkeleyfamily akeridaestanley kubrickrockrose family
...View all with 14 letters...
Words (5)
leukodystrophiesphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosisesPhrases (30)
strictly speakingfyodor dostoevskicapital of new yorkfriendly takeoverelwyn brooks whitepresident kennedyyellowfin croakersnowy tree cricketmockernut hickorykerry blue terrier
...View all with 16 letters...
Phrases (11)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykofrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneyayatollah ruholla khomeinidavid lewelyn wark griffithassyrian akkadian language
...View all with 24 letters...
Phrases (13)
francis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskypodkamennaya tunguska rivermikhail yurievich lermontovchamaecyparis nootkatensischronic myelocytic leukemiacommunist party of kampuchea
...View all with 25 letters...
Phrases (11)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitmikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventorymartin luther king jr's birthday
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay