Words Containing: K,Y,L,I,N,S
(In Any Order)
There are 100 words,
168 phrases and
0 abbr's with
K,Y,L,I,N,S in.
Best Scoring Words With: K,Y,L,I,N,S
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
skyline | 7 | 14 | nounn | |||||
noun • the outline of objects seen against the sky • the line at which the sky and Earth appear to meet | ||||||||
snakily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
slinky | 6 | 13 | noun, adjectiven, adj | |||||
noun • A three-dimensional curve — a spiral wound around a helix. adjective • Furtive, stealthy or catlike. • Thin; lank; lean. • Of a garment: close-fitting; clingy. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (27)
mistakenlyshockinglystrikinglyspankinglyprankishlysneakinglyhyperlinksshylockingskylarkingflunkyismsankylosingkindlesslystinkinglyskulkinglysneakishlyskimminglyskimpinglyskinflintyspeakinglyflunkeyishflunkeyismskippinglykeelyvinessmirkinglystrickenlyfriskinglyklendusityPhrases (2)
alkyd resinroy wilkinsPhrases (1)
employee stock ownership planPhrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay