Words Containing: K,R,Y
(In Any Order)
There are 981 words,
934 phrases and
0 abbr's with
K,R,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
quirky | 6 | 22 | adjectiveadj | |||||
adjective satellite • (informal) strikingly unconventional | ||||||||
jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
hayfork | 7 | 20 | nounn | |||||
noun • a long-handled fork for turning or lifting hay | ||||||||
jerky | 5 | 19 | noun, adjectiven, adj | |||||
noun • meat (especially beef) cut in strips and dried in the sun adjective satellite • lacking a steady rhythm • marked by abrupt transitions • having or revealing stupidity | ||||||||
parkway | 7 | 19 | nounn | |||||
noun • a wide scenic road planted with trees | ||||||||
hickory | 7 | 19 | nounn | |||||
noun • valuable tough heavy hardwood from various hickory trees • American hardwood tree bearing edible nuts | ||||||||
freckly | 7 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
hayrack | 7 | 19 | nounn | |||||
noun • a rack that holds hay for feeding livestock • a frame attached to a wagon to increase the amount of hay it can carry | ||||||||
byworks | 7 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
hayrick | 7 | 19 | nounn | |||||
noun • a stack of hay | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (124)
franklymockerypricklystarkeybarkleykryptonwrinklysparklyparkwayhickorycookerytrotskyricketyrookeryyonkersskylarkkeywordkeycardworkdayskywardgretzkybrisklystreakygromykostarklycracklyhackeryfrecklyyounkertricksyknaveryturnkeycrinklyrockeryshrieky
...View all with 7 letters...
Phrases (9)
dry kilndry milkkey ringkey wordfry cookwork daynew yorkback yerweak yerWords (145)
brooklynbackyardkeyboardberkeleyyearbookjunkyarddaybreaktrickerymalarkeyyarmulkeworkadaycrockerybodyworkvalkyrieteriyakibusyworkklystronkerenskyrockawayyarmulkamarkedlyskydiversikorskyquackeryrocketrygarlickydockyardrakishlymusketryskywardswhiskeryhaymakertrickilyfrolickykeynoter
...View all with 8 letters...
Phrases (13)
minor keyeasy markcooky jarscrew keykey fruitgreek keymajor keykorea baygarry oakcape york
...View all with 8 letters...
Words (169)
yorkshirereykjavikawkwardlystorybookskyrocketdrunkenlybreakawaytarkovskykimberleyyardstickjaywalkerplaymakerthackeraykeystrokecyberpunkstockyardjayhawkerskywriterkaryotypegimmickrycuckoldryhackberryhyperlinkbrickyardcrookedlyfancyworkeukaryoteberrylikekeynotersfairylikeperikaryabackstoryskydiverssyruplikeskylarker
...View all with 9 letters...
Phrases (46)
church keylike crazyevery weekgin rickeydry socketturkey legturkey redkey strokekeep relayreturn key
...View all with 9 letters...
Words (156)
bankruptcyremarkablyblackberryskyscraperbricklayerrecklesslystravinskymoneymakerfreakishlystrikinglyrockabillyskywritingeukaryoticpernicketylawyerlikedonnybrookprayerbooktrotskyiteankylosaurmerrymakerlukewarmlydonkeyworkgraywackestrickishlyprankishlykeystrokedcocksurelybackwardlyskylarkerscarrybacksskyrocketsjackasserychokeberrymythmakersbrickyards
...View all with 10 letters...
Phrases (70)
mary leakeybody of workmaxim gorkyprayer booktalk turkeyyard markerpastry cookkey patternalkyl groupgreek deity
...View all with 10 letters...
Words (108)
hypermarkethuckleberrybaryshnikovskulduggerypersnicketyjabberwockykeyboardistbricklayingmerrymakingkinyarwandaworkabilitychokecherryyastrzemskiprovokinglythankworthyhyperlinkedkeystrokingskyrocketedskyscrapersprokaryotesbricklayerskaryogamiesbookbinderydonnybrookskeyboardingmoneymakerskeypunchersbradykininsrekeyboardsgimcrackeryalkalimetrystringybarkkymographicbrainsicklyfactorylike
...View all with 11 letters...
Phrases (63)
like royaltypolicy makermackerel skydirty trickscelery stickback countryfunny remarkleon trotskymaksim gorkywhiskey sour
...View all with 11 letters...
Words (72)
skullduggeryhyperkalemiahyperkineticankylosauruscheckerberryholidaymakerhyperkineseshyperkinesiaheterokaryonhyperlinkingflickeringlymerrymakingsbricklayingskaryokinetichydrocrackedkeyboardistshyperkinesisunremarkablyrekeyboardedhypermarketsstringybarksblackguardlydaydreamlikekymographieskremlinologyhydrokineticdrinkabilityskyrocketingjourneyworkstracklayingskaryokineseskaryologicalkaryokinesishydrocrackerkeratoplasty
...View all with 12 letters...
Phrases (81)
jockey shortsrisky venturealkyl radicalboris spasskyalben barkleybrown hickoryup to your neckrhesus monkeyalfred kinseyyom kippur war
...View all with 12 letters...
Words (36)
marketabilityholidaymakersrekeyboardingunworkabilitymountebankeryphytoplankterhyperkinesiasheterokaryonsmegakaryocytehydrocrackingkindheartedlyhydrocrackersunshrinkinglythankworthilyhe-huckleberrybradykinesiasblackberryingfairnytickleskitty-corneredjawbreakinglycryoplanktonshydrokineticsremarkabilityknickknackeryheartbrokenlydusky-colouredhydraulickingpoikilothermyjiggery-pokeryforeknowinglykinesitherapyprickly-leafedprickly-leavedkeratomycosispsychometrika
...View all with 13 letters...
Phrases (75)
el iskandriyahbitter hickoryrobert m. yerkesturkey buzzardfactory workercocktail partynook and crannydorothy parkerthree kings' daynorfolk wherry
...View all with 13 letters...
Words (24)
hyperkeratoticleukodystrophyphytoplanktersankylosauruseskaryotypicallybreathtakinglyhyperkeratoseshyperkeratosisearthshakinglyheterokaryosesheterokaryosisheterokaryoticcantankerouslymegakaryocyticmegakaryocyteshydrocrackingshydrokineticalblackberry-lilyblackberryingshuckleberryingyekaterinoslavrimsky-korsakovkinematographybrachypinakoidPhrases (80)
drunken revelryveliky novgorodigor stravinskyemergency brakeblackberry bushold world monkeyturkey stuffingkyrgyz republicdynamic speakerkeynote address
...View all with 14 letters...
Words (7)
heartbreakinglyphenylketonuricphenylketonuriabrokenheartedlypoverty-strickenhuckleberryingsbrachypinakoidsPhrases (71)
erlenmeyer flaskmask of pregnancyturkey drumstickbuckthorn familycapital of turkeyalfred korzybskinetwork topologysecurity blanketandrei tarkovskymonkey-bread tree
...View all with 15 letters...
Words (7)
heterokontophytaleukodystrophiesphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosiseskrypterophaneronPhrases (65)
strictly speakingcock-and-bull storyfyodor dostoevskifyodor dostoevskycapital of new yorkfriendly takeoverfrank lloyd wrightelwyn brooks whitefeodor dostoevskyassyrian akkadian
...View all with 16 letters...
Phrases (12)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykofrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneyayatollah ruholla khomeinidavid lewelyn wark griffithassyrian akkadian language
...View all with 24 letters...
Phrases (17)
igor fyodorovich stravinskyfrancis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskypodkamennaya tunguska rivermikhail yurievich lermontovchamaecyparis nootkatensischronic myelocytic leukemia
...View all with 25 letters...
Phrases (11)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitmikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventorymartin luther king jr's birthday
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay