Words Containing: K,R,T,Y
(In Any Order)
There are 261 words,
526 phrases and
0 abbr's with
K,R,T,Y in.
Best Scoring Words With: K,R,T,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| krypton | 7 | 16 | nounn | |||||
noun • a colorless element that is one of the six inert gasses; occurs in trace amounts in air | ||||||||
| rickety | 7 | 16 | adjectiveadj | |||||
adjective satellite • inclined to shake as from weakness or defect • affected with, suffering from, or characteristic of rickets • lacking bodily or muscular strength or vitality | ||||||||
| tricksy | 7 | 16 | adjectiveadj | |||||
adjective satellite • marked by skill in deception | ||||||||
| rackety | 7 | 16 | adjectiveadj | |||||
adjective satellite • uncontrollably noisy | ||||||||
| trickly | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
| tricky | 6 | 15 | adjectiveadj | |||||
adjective satellite • not to be trusted • having concealed difficulty • marked by skill in deception | ||||||||
| streaky | 7 | 14 | adjectiveadj | |||||
adjective satellite • marked with or as if with stripes or linear discolorations | ||||||||
| starkly | 7 | 14 | adverbadv | |||||
adverb • in a stark manner • in sharp outline or contrast • in a blunt manner | ||||||||
| turnkey | 7 | 14 | noun, adjectiven, adj | |||||
noun • someone who guards prisoners | ||||||||
| autarky | 7 | 14 | noun, adjectiven, adj | |||||
noun • economic independence as a national policy | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
trykeWords (44)
storybookskyrockettarkovskyyardstickthackeraykeystrokestockyardskywriterkaryotypeeukaryotekeynotersbackstoryteriyakismythmakertrackwayskerygmatatrinketrystreakilyklystronsyakitoriskryoliteskryolithsskywritestriweeklykaryotinssatyrliketinkertoykalyptrasstaymakertraffickyflystrikehucksterystylemarkakaryotesakaryotic
...View all with 9 letters...
Phrases (20)
dry socketturkey legturkey redkey strokereturn keywork partyyoung turkmarket dayyak buttertom turkey
...View all with 9 letters...
Words (54)
bankruptcystravinskystrikinglyskywritingeukaryoticpernicketytrotskyitetrickishlykeystrokedskyrocketsmythmakerskerygmaticyardstickskeystrokesprokaryotestockyardsskywritersskywrittenstorybookskaryotypedkaryotypeskaryotypictracklayereukaryotestinkertoyskeratotomyperjinketyperjinkitytewkesburypyknometerstaymakersmarketablystony-brokeflystrikespastrycook
...View all with 10 letters...
Phrases (29)
talk turkeypastry cookkey patterngreek deitygray marketrock pythonforty winkskidney wortplay tricksgrey market
...View all with 10 letters...
Words (41)
hypermarketpersnicketykeyboardistworkabilityyastrzemskithankworthykeystrokingskyrocketedprokaryotesalkalimetrystringybarkfactorylikeprokaryoticbackcountryskywritingstracklayerstracklayingkaryotypingcomstockerykleptocracypyknometerstricklinglykitty-cornerdeuterotokyturkey-sizedkeratectomyrheumatickypastrycookskyrgyzstanikeratophyrecountryfolkfernyticklekarstifyingtracklesslykaryologist
...View all with 11 letters...
Phrases (29)
like royaltydirty trickscelery stickback countryleon trotskythorny skatekitty litterparity checkdyer's rocketvarsity sock
...View all with 11 letters...
Words (27)
hyperkineticheterokaryonkaryokinetickeyboardistshypermarketsstringybarkshydrokineticdrinkabilityskyrocketingtracklayingskeratoplastypony-trekkingkeystrokingsrevokabilityfairnyticklemockumentarystravinskyankeratophyrescryoplanktonstockjobberyfernytickleskakistocracykaryologistsbreakabilitykaryotypicallocksmitherykeratohyalinPhrases (34)
jockey shortsrisky ventureup to your neckpatrick henryliterary workworking partydavy crockettplay a trick onthink factoryvervet monkey
...View all with 12 letters...
Words (19)
marketabilityunworkabilitymountebankeryphytoplankterheterokaryonsmegakaryocytekindheartedlythankworthilyfairnytickleskitty-corneredcryoplanktonshydrokineticsremarkabilityheartbrokenlypoikilothermykinesitherapykeratomycosispsychometrikashockumentaryPhrases (40)
bitter hickoryrobert m. yerkesturkey buzzardfactory workercocktail partydorothy parkerthree kings' dayrayon stockingsilky wisteriatank destroyer
...View all with 13 letters...
Words (17)
hyperkeratoticleukodystrophyphytoplankterskaryotypicallybreathtakinglyhyperkeratoseshyperkeratosisearthshakinglyheterokaryosesheterokaryosisheterokaryoticcantankerouslymegakaryocyticmegakaryocyteshydrokineticalyekaterinoslavkinematographyPhrases (38)
igor stravinskyturkey stuffingkeynote addressstrawberry marksouth yorkshirebuckthorn berrypulmonary trunkstanley kubrickdesk dictionarysympathy strike
...View all with 14 letters...
Words (6)
heterokontophytaleukodystrophiesphenylketonuriasphenylketonuricsheterokaryosiseskrypterophaneronPhrases (43)
strictly speakingcock-and-bull storyfyodor dostoevskifyodor dostoevskycapital of new yorkfriendly takeoverfrank lloyd wrightelwyn brooks whitefeodor dostoevskytrackless trolley
...View all with 16 letters...
Phrases (17)
igor fyodorovich stravinskyfrancis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskypodkamennaya tunguska rivermikhail yurievich lermontovchamaecyparis nootkatensischronic myelocytic leukemia
...View all with 25 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
enzyme-linked-immunosorbent serologic assay
