Words Containing: K,N,Y
(In Any Order)
There are 874 words,
848 phrases and
0 abbr's with
K,N,Y in.
Best Scoring Words With: K,N,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| zinkify | 7 | 26 | ||||||
Valid word for Scrabble US
| ||||||||
| zincky | 6 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| zinky | 5 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| knuckly | 7 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| yakking | 7 | 19 | verb, adverbv, adv | |||||
noun • noisy talk • large long-haired wild ox of Tibet often domesticated verb • talk profusely | ||||||||
| hackney | 7 | 19 | noun, adjectiven, adj | |||||
noun • a carriage for hire • a compact breed of harness horse | ||||||||
| finicky | 7 | 19 | adjectiveadj | |||||
adjective satellite • exacting especially about details | ||||||||
| yukking | 7 | 19 | verb, nounv, n | |||||
verb • To laugh exuberantly. | ||||||||
| wryneck | 7 | 19 | nounn | |||||
noun • an unnatural condition in which the head leans to one side because the neck muscles on that side are contracted • Old World woodpecker with a peculiar habit of twisting the neck | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (107)
franklykennedyunluckycockneykryptonwrinklyskylineyakkingkeynotepanickyhackneyblanklyfinickyyonkersflunkeynakedlypinkeyeyounkerknaveryturnkeycrinklyvandyketwinklykyanitelinkboyknobblyryokansmonkeysunyokedunyokesyankingsnakilyalkyneskidneyspyknics
...View all with 7 letters...
Phrases (11)
dry kilnkey ringeye bankyoko ononew yorknyse mktzyklon avan dyckvan eyckinky cap
...View all with 7 letters...
Words (118)
brooklynunlikelykentuckyjunkyardmckinleykeystonekennellyjokinglyunkindlyklystronkerenskynijinskyknightlycytokinesneakilyblanketymonkeyedkolinskyhymnbookknottilykeynotedkeynoterkayakingslinkilyswankilyhymnlikeflunkeysskylinesunyokingclaybanklinkboysfinnickynitpickyeyewinkssnarkily
...View all with 8 letters...
Phrases (11)
minor keythank youeye blinkken keseyinbus keystink flytonic keypink ladyallen keynaked eye
...View all with 8 letters...
Words (128)
knowinglyskydivingbuttinskymockinglydrunkenlyunluckilykeynesianmonkeyingwyszynskijockeyinghackneyedgunnysackcyberpunkkandinskyhaymakingankylosishyperlinkknavishlyfancyworkbumpkinlykeybuttonkeynotersyuckinessquakinglyhymnbooksmonkeyishnonstickyankylosedankyloticrockinglykiddinglygymkhanastrinketrywinkinglykillingly
...View all with 9 letters...
Phrases (38)
lake nyasagin rickeygunny sackreturn keyjack bennyyoung turkangry walkduke waynehoney cakemike tyson
...View all with 9 letters...
Words (129)
bankruptcythankfullymistakenlyshockinglystravinskymoneymakerstrikinglyskywritingpernicketyspankinglyunshakablyunladylikepickaninnydonnybrookalkalinitydyskinesiaankylosaurdonkeyworkplaymakingkeypunchesprankishlykanamycinsdyskineticsneakinglymythmakingthinkinglyalkylatingkeybuttonsgunnysackskeypunchedkeypuncherungimmickyhyperlinksbradykininzinkifying
...View all with 10 letters...
Phrases (62)
mt. mckinleygenus khayakey patternjohnny cakeup to my neckpaying backpink familyhook and eyenew york baypyknic type
...View all with 10 letters...
Words (111)
unknowinglyhoneysucklebaryshnikovunspeakablyyellowknifepersnicketymonkeyshinekinesiologybricklayingsickeninglymoneymakingmerrymakingkinyarwandatiddlywinksyevtushenkounthinkablyprovokinglythankworthyoutspokenlyhyperlinkedkeystrokingflyspeckingbankabilitybookbinderyalkylationshokeynesseschucklinglychimneylikecytokinesesdonnybrookskeyboardingplaymakingsmoneymakerskeypuncherskeypunching
...View all with 11 letters...
Phrases (52)
glossy snakekeep an eye onclosely knittightly knitback countryfunny remarkleon trotskyannie oakleywhiskey neatplay a joke on
...View all with 11 letters...
Words (76)
unmistakablystanislavskyhyperkineticunthinkinglyankylosaurusmoneymakingshyperkineseshyperkinesiaheterokaryonhyperlinkinghoneysucklesunskillfullyunblinkinglymonkeyshinesflickeringlymerrymakingsbricklayingskaryokineticcytoskeletoncockeyednesshyperkinesisunremarkablycockneyfyingpaddywackingstringybarkspiggybackingkremlinologyhydrokineticdrinkabilityskyrocketingjourneyworkstracklayingsbodycheckingkaryokinesesbackhandedly
...View all with 12 letters...
Phrases (68)
body stockinghockey clinicshaking palsyrisky ventureginkgo familyalben barkleybrown hickoryup to your neckrhesus monkeya. noam chomsky
...View all with 12 letters...
Words (39)
painstakinglyphytoplanktonpsychokineticpsychokinesiscytoskeletonsknowledgeablyrekeyboardingunworkabilitymountebankeryphytoplankterhyperkinesiasheterokaryonshydrocrackingtiddledywinkspsychokinesesunknowabilitykindheartedlykinematicallyunshrinkinglythankworthilybradykinesiasstickybeakingblackberryingfairnytickleskitty-corneredjawbreakinglyginkgophytinacryoplanktonshydrokineticsdostoyevskianknickknackeryheartbrokenlyunmistakeablyankyloglossiahydraulicking
...View all with 13 letters...
Phrases (75)
el iskandriyahyakut languagemount mckinleyjekyll and hydenook and crannythree kings' daynylon stockingnorfolk wherryanxiety attackbanking system
...View all with 13 letters...
Words (19)
unthinkabilityphytoplanktersankylosaurusesbreathtakinglycockeyednessesearthshakinglycantankerouslyacknowledgedlyphytoplanktonshydrocrackingshydrokineticalblackberryingsvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketonekinematographybrachypinakoidPhrases (79)
anthony van dyckanthony vandykedimethyl ketonedrunken revelryveliky novgorodigor stravinskyemergency brakecapital of kenyablended whiskeyold world monkey
...View all with 14 letters...
Words (20)
heartbreakinglykinestheticallyankylostomiasesankylostomiasisphenylketonuriccholecystokinintelekineticallyphytoplanktonicphenylketonuriabrokenheartedlypyknodysostosespyknodysostosisknowledgabilitycockneyficationkenogeneticallypoverty-strickenacknowledgeablyhuckleberryingsdiphenylketonesbrachypinakoidsPhrases (64)
erlenmeyer flaskmask of pregnancykeep one's eyes offbuckthorn familydocking facilitynetwork topologysecurity blanketandrei tarkovskymonkey-bread treewilliam mckinley
...View all with 15 letters...
Words (8)
heterokontophytakinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskcholecystokininskrypterophaneronknowledgeabilityPhrases (54)
strictly speakingalan lloyd hodgkincock-and-bull storycapital of new yorkfriendly takeoverfrank lloyd wrightfamily gekkonidaeelwyn brooks whiteassyrian akkadiancreek confederacy
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (32)
nikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynsri lankan monetary unitisle royal national parksoren aabye kierkegaardpakistani monetary unitjohn fitzgerald kennedythomas kennerly wolfe jr.sir john cowdery kendrew
...View all with 21 letters...
Phrases (12)
division heterokontophytaandrei andreyevich gromykosubdivision ginkgophytinafrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneylucy in the sky with diamondsayatollah ruholla khomeinidavid lewelyn wark griffith
...View all with 24 letters...
Phrases (16)
igor fyodorovich stravinskyfrancis scott key fitzgeraldtrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskypodkamennaya tunguska rivercygnus columbianus bewickiimikhail yurievich lermontovchamaecyparis nootkatensischronic myelocytic leukemia
...View all with 25 letters...
Phrases (11)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskyuniversity of nebraska-lincolnkennedy international airporteysenck personality inventorymartin luther king jr's birthday
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
