Words Containing: K,N,S,Y
(In Any Order)
There are 404 words,
432 phrases and
0 abbr's with
K,N,S,Y in.
Best Scoring Words With: K,N,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pyknics | 7 | 18 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
skanky | 6 | 17 | adjectiveadj | |||||
adjective satellite • highly offensive; arousing aversion or disgust | ||||||||
skunky | 6 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
honkeys | 7 | 17 | nounn | |||||
noun • (slang) offensive names for a White man | ||||||||
hunkeys | 7 | 17 | ||||||
Valid word for Scrabble US
| ||||||||
swanky | 6 | 16 | adjectiveadj | |||||
adjective satellite • imposingly fashionable and elegant | ||||||||
monkeys | 7 | 16 | nounn | |||||
noun • any of various long-tailed primates (excluding the prosimians) • one who is playfully mischievous verb • play around with or alter or falsify, usually secretively or dishonestly • do random, unplanned work or activities or spend time idly | ||||||||
punkeys | 7 | 16 | ||||||
noun • minute two-winged insect that sucks the blood of mammals and birds and other insects | ||||||||
pinkeys | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
spunky | 6 | 15 | adjectiveadj | |||||
adjective satellite • showing courage • willing to face danger | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (37)
skylineyonkersryokansmonkeysunyokessnakilyalkyneskidneyspyknicsenskyedpunkeyskyanisedinkeyshonkeyshunkeysstenokydonkeyspinkeyskeyingsskryingswankeyskybornkyogensskyfingskyringyokingsyankersnynorskyankiesskytingjanskyslysenkokonfytshawkynskaryons
...View all with 7 letters...
Phrases (1)
nyse mktWords (49)
keystoneklystronkerenskynijinskysneakilykolinskyslinkilyswankilyflunkeysskylineslinkboyseyewinkssnarkilykeynotespyknosesenskyingkyanisedkyaniseskyanitescockneyskyanizeshackneysvandykesskyborneturnkeyssynkaryasnickerykryptonspyknosisankyloseladykinsyounkerswryneckspinkeyesspunkily
...View all with 8 letters...
Phrases (3)
ken keseyinbus keystink flyWords (56)
skydivingbuttinskykeynesianwyszynskigunnysackkandinskyankylosisknavishlykeynotersyuckinesshymnbooksmonkeyishnonstickyankylosedgymkhanaskeystoneskayakingskyanisingdisyokingkyboshingmisyokingklystronscryobanksmonkishlyflunkyismsynkaryonyokozunasclaybankseyeblinksankylosesjunkyardsskivvyingkaryotinssicklyinghokeyness
...View all with 9 letters...
Phrases (12)
lake nyasagunny sackmike tysonsnake eyesh. j. eysencksneak awaylyre snakecandy kissthe skinnyskinny tie
...View all with 9 letters...
Words (75)
mistakenlyshockinglystravinskystrikinglyskywritingspankinglyunshakablydyskinesiaankylosaurkeypunchesprankishlykanamycinsdyskineticsneakinglykeybuttonsgunnysackshyperlinkscockneyishcockneyismjonnycakesphysickingskydivingsshylockingmonkeypodsmonkeypotsskyjackingskylarkingflunkyismssynkaryonsskysurfingcyberpunksskywrittenankylosingnewsweeklykindlessly
...View all with 10 letters...
Phrases (12)
genus khayaforty winksoxygen maskoyster bankalkyd resinshank's ponyshanks' ponykansas citycorn whiskyroy wilkins
...View all with 10 letters...
Words (68)
honeysucklebaryshnikovunspeakablypersnicketymonkeyshinekinesiologysickeninglytiddlywinksyevtushenkooutspokenlykeystrokingflyspeckingalkylationshokeynessescytokinesesdonnybrooksplaymakingsmoneymakerskeypunchersbradykininscockneyfiesdyskinesiascockneyismsyuckinessesstringybarklymphokinesskyjackingsbrainsicklyskywritingsankylosaursmythmakingsjohnnycakeskittenishlycytokinesisdonkeyworks
...View all with 11 letters...
Phrases (18)
glossy snakeclosely knitleon trotskywhiskey neatnoam chomskythorny skateskeleton keybrass monkeyloosely knitstinking yew
...View all with 11 letters...
Words (45)
unmistakablystanislavskyankylosaurusmoneymakingshyperkineseshyperkinesiahoneysucklesunskillfullymonkeyshinesmerrymakingsbricklayingscytoskeletoncockeyednesshyperkinesisstringybarksskyrocketingjourneyworkstracklayingskaryokineseskitschifyingkaryokinesiskeyboardingsgallygaskinspinnywinklesbradykinesiakyanisationshoneysuckershoneysuckledkeystrokingskyanizationsstravinskyankeynesianismtiddleywinkspennywinklesalkalescency
...View all with 12 letters...
Phrases (19)
body stockingshaking palsyrisky venturerhesus monkeya. noam chomskystock companyalfred kinseydenmark veseyhockey seasonsoaking syrup
...View all with 12 letters...
Words (20)
painstakinglypsychokineticpsychokinesiscytoskeletonshyperkinesiasheterokaryonstiddledywinkspsychokinesesunshrinkinglybradykinesiasstickybeakingfairnyticklescryoplanktonshydrokineticsdostoyevskianunmistakeablyankyloglossiakenyapithecuskinesitherapyshockumentaryPhrases (36)
el iskandriyahthree kings' daynylon stockingbanking systemvan wyck brooksrayon stockingryukyu islandstank destroyeryellowish pinkgenus kennedya
...View all with 13 letters...
Words (11)
phytoplanktersankylosaurusescockeyednessesearthshakinglycantankerouslyphytoplanktonshydrocrackingsblackberryingsvelvety-skinnedyekaterinoslavladylikenessesPhrases (38)
igor stravinskyblended whiskeyemily dickinsonturkey stuffingdynamic speakerkeynote addresshenry kissingersleepy sicknessmonkey businessostyak language
...View all with 14 letters...
Words (10)
kinestheticallyankylostomiasesankylostomiasischolecystokininpyknodysostosespyknodysostosispoverty-strickenhuckleberryingsdiphenylketonesbrachypinakoidsPhrases (34)
erlenmeyer flaskmask of pregnancykeep one's eyes offsecurity blanketandrei tarkovskyjan amos komenskygenus myxinikelaanthony comstocksprinkler systemfrancis scott key
...View all with 15 letters...
Words (5)
kinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskcholecystokininsPhrases (31)
strictly speakingcock-and-bull storyelwyn brooks whiteassyrian akkadiancoral honeysucklepresident kennedyrodya raskolnikovsnowy tree cricketwassily kandinskiwassily kandinsky
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (25)
nikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynsri lankan monetary unitisle royal national parksoren aabye kierkegaardpakistani monetary unitthomas kennerly wolfe jr.sir john cowdery kendrewpresident john f. kennedy
...View all with 21 letters...
Phrases (12)
igor fyodorovich stravinskyfrancis scott key fitzgeraldtrans-alaska pipeline systemandrei arsenevich tarkovskypodkamennaya tunguska rivercygnus columbianus bewickiichamaecyparis nootkatensisfederal home loan bank systemhenry kenneth alfred russellcommunist party of kampuchea
...View all with 25 letters...
Phrases (1)
employee stock ownership planPhrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay