Words Containing: K,L,T,Y
(In Any Order)
There are 233 words,
362 phrases and
0 abbr's with
K,L,T,Y in.
Best Scoring Words With: K,L,T,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
klutzy | 6 | 22 | adjectiveadj | |||||
adjective • Awkward, clumsy or socially inept | ||||||||
thickly | 7 | 19 | adverbadv | |||||
adverb • spoken with poor articulation as if with a thick tongue • in a concentrated manner • with a thick consistency • with thickness; in a thick manner • in quick succession | ||||||||
twinkly | 7 | 17 | adjectiveadj | |||||
adjective satellite • smiling with happiness or optimism | ||||||||
lekythi | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
trickly | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
bytalks | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
tackily | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
bytalk | 6 | 15 | adverb, nounadv, n | |||||
Valid word for Scrabble US
| ||||||||
talcky | 6 | 15 | verbv | |||||
Valid word for Scrabble US
| ||||||||
starkly | 7 | 14 | adverbadv | |||||
adverb • in a stark manner • in sharp outline or contrast • in a blunt manner | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (32)
leukocyteankyloticleukotomylatchkeyssketchilystreakilyplastickyklystronskilobytesskylightsyeastlikekryoliteskryolithsthinkablytriweeklyputtylikealkylatedalkylateseyestalkssatyrlikestylebookthylakoidkalyptraskvetchilyflystrikeunkemptlystylemarkthelytokykitschilyricketilykallitypekalotypesPhrases (4)
turkey legcity blockmyrtle oakempty talkWords (37)
thankfullymistakenlystrikinglylikabilityalkalinitytrickishlyskylightedskeletallythinkinglyalkylatingskittishlystylebooksleukocytesleukocyticticklishlyalkylationtracklayerstinkinglythylakoidsmarketablyscythelikesooty-blackbillystickflystrikesskinflintystockishlyunknightlystrokeplaymistakablytiddlywinkkaryolyticwalky-talkystrickenlykallitypestinklingly
...View all with 10 letters...
Phrases (12)
mt. mckinleytalk turkeysafety lockplay tricksflame tokaylickety cutcontrol keytally clerkstroke playkoto player
...View all with 10 letters...
Words (32)
skepticallyworkabilitytiddlywinksunthinkablytalkativelyoutspokenlybankabilityalkylationsalkalimetryfactoryliketracklayerstracklayingkittenishlypackabilitykineticallythanklesslykleptocracytricklinglytiddleywinkcountryfolkmistakeablykosteletzyathelytokiesthelytokousfernytickletracklesslypoikilocytekaryologistplatykurtictalkabilitybialystokertiggywinklePhrases (18)
like royaltybilly the kidclosely knittightly knitemmett kellycelery stickstock symbolleon trotskysystem clockskeleton key
...View all with 11 letters...
Words (28)
unmistakablystanislavskyunthinkinglycytoskeletonleukocytosiscytoskeletalleukocytosesdrinkabilitytracklayingskeratoplastyrevokabilityfairnytickleleukocytoticcryoplanktontiddledywinktiddleywinksfernyticklespoikilocyteskaryologistsunthankfullybreakabilitykaryotypicalpancake-stylelocksmitherytiggywinklesshockabilitykeratohyalinstickabilityPhrases (23)
lickety splityellow jackettake kindly toliterary workplay a trick onturk's cap-lilylaundry truckreality checkmilitary rankplymouth rock
...View all with 12 letters...
Words (21)
painstakinglymarketabilityphytoplanktoncytoskeletonsunworkabilityphytoplanktertiddledywinksunknowabilitykindheartedlykinematicallythankworthilyfairnyticklesclickety-clackclickety-clickcryoplanktonsremarkabilityheartbrokenlyunmistakeablypoikilothermysketchabilitykatabolicallyPhrases (26)
yakut languagemount mckinleycocktail partynylon stockingwhiskey bottlesilky wisteriaboykinia elatalaundry basketnonfat dry milkturkey vulture
...View all with 13 letters...
Words (13)
unthinkabilityleukodystrophyphytoplankterskaryotypicallybreathtakinglyearthshakinglycantankerouslyphytoplanktonshydrokineticalleukocytosisesvelvety-skinnedyekaterinoslavdiphenylketonePhrases (31)
dimethyl ketonecapital of kenyaskeletal systempulmonary trunkvotyak languageostyak languagestanley kubricklake tanganyikablackfoot daisysalisbury steak
...View all with 14 letters...
Words (14)
heartbreakinglykinestheticallyankylostomiasesankylostomiasisphenylketonuriccholecystokinintelekineticallyphytoplanktonicphenylketonuriabrokenheartedlyknowledgabilitykenogeneticallylymphoblast-likediphenylketonesPhrases (22)
buckthorn familycapital of turkeydocking facilitynetwork topologysecurity blanketmarketable yieldocellated turkeyfamily triakidaesprinkler systemstinking gladwyn
...View all with 15 letters...
Words (6)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsknowledgeabilityPhrases (28)
strictly speakinghypophyseal stalkcock-and-bull storycapital of new yorkfriendly takeoverfrank lloyd wrightelwyn brooks whitetrackless trolleycomstock mealybugkerry blue terrier
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (24)
aleksandr solzhenitsynsri lankan monetary unitisle royal national parkjohn fitzgerald kennedythomas kennerly wolfe jr.musculoskeletal systemthin-leaved stringybarkketamine hydrochloridepeter ilich tchaikovskylymphoblastic leukemia
...View all with 21 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
enzyme-linked-immunosorbent serologic assay