Words Containing: K,I,N,S,E,Y
(In Any Order)
There are 126 words,
250 phrases and
0 abbr's with
K,I,N,S,E,Y in.
Best Scoring Words With: K,I,N,S,E,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pinkeys | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
kidneys | 7 | 15 | nounn | |||||
noun • either of two bean-shaped excretory organs that filter wastes (especially urea) from the blood and excrete them and water in urine | ||||||||
dinkeys | 7 | 15 | nounn | |||||
noun • a small locomotive | ||||||||
skyline | 7 | 14 | nounn | |||||
noun • the outline of objects seen against the sky • the line at which the sky and Earth appear to meet | ||||||||
kyanise | 7 | 14 | ||||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
kinseyWords (25)
persnicketymonkeyshinekinesiologysickeninglykeystrokingflyspeckingcytokinesescockneyfiesdyskinesiascockneyismsyuckinesseslymphokineskittenishlycytokinesischelyabinskspiny-backedteknonymieshackneyismsgreyish-pinkflunkeyismsshriekinglypyrokinesespyrokinesissqueakinglykinesipathyPhrases (9)
closely knitwhiskey neatloosely knitstinking yewcorn whiskeysydney silkysilky cornelkidney stonesoybean milkWords (22)
moneymakingshyperkineseshyperkinesiamonkeyshinesmerrymakingshyperkinesisskyrocketingkaryokineseskaryokinesiskeyboardingspinnywinklesbradykinesiakeystrokingskeynesianismtiddleywinkspennywinklesladylikenessfernyticklesskinny-dipperchimneystacktiggywinkleskidney-shapedPhrases (5)
risky venturealfred kinseykey signaturespider monkeynew york stripWords (13)
psychokineticpsychokinesishyperkinesiastiddledywinkspsychokinesesbradykinesiasstickybeakingfairnytickleshydrokineticsdostoyevskianunmistakeablykenyapithecuskinesitherapyPhrases (13)
el iskandriyahthree kings' daybanking systemyellowish pinkgenus boykiniablended whiskysiberian huskyorkney islandserwin panofskytrofim lysenko
...View all with 13 letters...
Words (6)
kinestheticallyankylostomiasescholecystokininpoverty-strickenhuckleberryingsdiphenylketonesPhrases (20)
security blanketandrei tarkovskygenus myxinikelasprinkler systemfrancis scott keypinckneya pubensstinking mayweedstringybark pinenickel-base alloyproboscis monkey
...View all with 15 letters...
Words (5)
kinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskcholecystokininsPhrases (14)
strictly speakingelwyn brooks whitepresident kennedysnowy tree cricketproperly speakingbenjamin kubelskywhite honeysucklemyxinikela sirokablack cypress pinehairy honeysuckle
...View all with 16 letters...
Phrases (1)
employee stock ownership planPhrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay