Words Containing: K,I,L,T,Y
(In Any Order)
There are 162 words,
267 phrases and
0 abbr's with
K,I,L,T,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
thickly | 7 | 19 | adverbadv | |||||
adverb • spoken with poor articulation as if with a thick tongue • in a concentrated manner • with a thick consistency • with thickness; in a thick manner • in quick succession | ||||||||
twinkly | 7 | 17 | adjectiveadj | |||||
adjective satellite • smiling with happiness or optimism | ||||||||
lekythi | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
trickly | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
tackily | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
toylike | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
tinkly | 6 | 13 | adjectiveadj | |||||
adjective satellite • like the short high ringing sound of a small bell | ||||||||
skylit | 6 | 13 | adjectiveadj | |||||
adjective • Receiving all or most light from the sky • Furnished with one or more skylights. | ||||||||
kilty | 5 | 12 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
kiltyWords (28)
mistakenlystrikinglylikabilityalkalinitytrickishlyskylightedthinkinglyalkylatingskittishlyleukocyticticklishlyalkylationstinkinglythylakoidsscythelikebillystickflystrikesskinflintystockishlyunknightlymistakablytiddlywinkkaryolyticstrickenlykallitypestinklinglykelyphiticklendusityPhrases (4)
mt. mckinleyplay trickslickety cutmalt whiskyWords (24)
skepticallyworkabilitytiddlywinksunthinkablytalkativelybankabilityalkylationsalkalimetryfactoryliketracklayingkittenishlypackabilitykineticallytricklinglytiddleywinkmistakeablythelytokiesfernyticklepoikilocytekaryologistplatykurtictalkabilitybialystokertiggywinklePhrases (12)
like royaltybilly the kidclosely knittightly knitcelery stickloosely knitkitty litterplain turkeymalt whiskeycrystal mike
...View all with 11 letters...
Words (21)
unmistakablystanislavskyunthinkinglyleukocytosisdrinkabilitytracklayingsrevokabilityfairnytickleleukocytotictiddledywinktiddleywinksfernyticklespoikilocyteskaryologistsbreakabilitykaryotypicallocksmitherytiggywinklesshockabilitykeratohyalinstickabilityPhrases (15)
lickety splittake kindly toliterary workplay a trick onturk's cap-lilyreality checkmilitary rankliterary hacksalt lake citymickey mantle
...View all with 12 letters...
Words (16)
painstakinglymarketabilityunworkabilitytiddledywinksunknowabilitykindheartedlykinematicallythankworthilyfairnyticklesclickety-clackclickety-clickremarkabilityunmistakeablypoikilothermysketchabilitykatabolicallyPhrases (15)
mount mckinleycocktail partynylon stockingwhiskey bottlesilky wisteriaboykinia elatanonfat dry milkkeyhole limpetlatchkey childtrofim lysenko
...View all with 13 letters...
Words (9)
unthinkabilitykaryotypicallybreathtakinglyearthshakinglyhydrokineticalleukocytosisesvelvety-skinnedyekaterinoslavdiphenylketonePhrases (21)
dimethyl ketonecapital of kenyastanley kubricklake tanganyikablackfoot daisysalisbury steakeucalyptus kinovalley white oakpiggyback plantpink fritillary
...View all with 14 letters...
Words (13)
heartbreakinglykinestheticallyankylostomiasesankylostomiasisphenylketonuriccholecystokinintelekineticallyphytoplanktonicphenylketonuriaknowledgabilitykenogeneticallylymphoblast-likediphenylketonesPhrases (16)
buckthorn familycapital of turkeydocking facilitysecurity blanketmarketable yieldfamily triakidaesprinkler systemstinking gladwynlashkar-e-tayyibaalkylating agent
...View all with 15 letters...
Words (6)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsknowledgeabilityPhrases (17)
strictly speakingcapital of new yorkfriendly takeoverfrank lloyd wrightelwyn brooks whitekerry blue terrierradial keratotomywhite honeysucklerepublic of turkeymilitary blockade
...View all with 16 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
enzyme-linked-immunosorbent serologic assay