Words Containing: K,E,Y
(In Any Order)
There are 1,348 words,
1,121 phrases and
2 abbr's with
K,E,Y in.
Best Scoring Words With: K,E,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| squeaky | 7 | 23 | adjectiveadj | |||||
adjective satellite • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
| jockeys | 7 | 23 | nounn | |||||
noun • someone employed to ride horses in horse races • an operator of some vehicle or machine or apparatus verb • defeat someone through trickery or deceit • compete (for an advantage or a position) • ride a racehorse as a professional jockey | ||||||||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| jockey | 6 | 22 | verb, nounv, n | |||||
noun • someone employed to ride horses in horse races • an operator of some vehicle or machine or apparatus verb • defeat someone through trickery or deceit • compete (for an advantage or a position) • ride a racehorse as a professional jockey | ||||||||
| kvetchy | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
| whiskey | 7 | 20 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
| keyways | 7 | 20 | nounn | |||||
noun • A slot into which a precision attachment (a key) is fitted. | ||||||||
| hawkeys | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| jerky | 5 | 19 | noun, adjectiven, adj | |||||
noun • meat (especially beef) cut in strips and dried in the sun adjective satellite • lacking a steady rhythm • marked by abrupt transitions • having or revealing stupidity | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (180)
whiskeykennedysqueakymockerystarkeybarkleysketchycockneyskylinekeyholecookeryweekdayricketykeynotehackneyrookerybuckeyeyonkerskeywordkeycardgretzkyflunkeypasskeysockeyestreakybeckleynakedlyskydivepinkeyehackeryfrecklyyounkerknaveryturnkeyvandyke
...View all with 7 letters...
Phrases (20)
egg yolkeye maskde bakeyhome keykey limekey palmkey ringkey westkey wordeye bank
...View all with 7 letters...
Words (208)
unlikelykentuckykeyboardpaycheckberkeleyyearbookdaybreakmckinleytrickeryweekdayskeystonemalarkeykennellyladyliketakeawayyarmulkecrockeryvalkyriewickedlyteriyakicockeyedflyspeckkerenskymarkedlylatchkeyskydivershockleyjockeyedquackerycytokinerocketrybiweeklysneakilykilobytemusketry
...View all with 8 letters...
Phrases (27)
minor keyeye blinkken keseymilk wheyeasy markinbus keyholy weekkay boylescrew keywatch key
...View all with 8 letters...
Words (199)
speakeasyyorkshirereykjavikskyrocketdrunkenlybreakawaykimberleykeynesianmonkeyingjaywalkerplaymakerjockeyingdoohickeythackerayhackneyedkeystrokecyberpunkleukocytejellylikejayhawkerskywriterkaryotypehackberryhyperlinkcrookedlypuppylikeeukaryotesylphlikeberrylikekeybuttonpaycheckskeynotersyuckinesswakefullyfairylike
...View all with 9 letters...
Phrases (66)
lake nyasachurch keylike crazyevery weekgin rickeydry socketjockey capturkey legturkey redkey stroke
...View all with 9 letters...
Words (176)
remarkablyblackberrymistakenlyskyscraperbricklayerrecklesslydostoevskymoneymakerfreakishlyeukaryoticpernicketylawyerlikeunladylikeprayerbookdyskinesiatrotskyitemerrymakerlukewarmlydonkeyworkgraywackeskeypuncheskeystrokeddyskineticcocksurelyskylarkersskylightedsneakinglyyokefellowskyrocketsskeletallyjackasserychokeberrymythmakerskerygmaticstylebooks
...View all with 10 letters...
Phrases (93)
mary leakeymt. mckinleygenus khayaprayer booktalk turkeyyard markerkey patternisle of skyejohnny cakegreek deity
...View all with 10 letters...
Words (142)
hypermarketdostoyevskyhuckleberryhoneysuckleunspeakablyskulduggeryyellowknifepersnicketyhypokalemiamonkeyshinehypokalemickinesiologyjabberwockykeyboardistsickeninglymoneymakingmerrymakingskepticallychokecherryyastrzemskiyevtushenkotalkativelyoutspokenlyhyperlinkedkeystrokingflyspeckingpiggybackedyokefellowsskyrocketedskyscrapersprokaryotesbricklayersbodycheckedkaryogamiesbookbindery
...View all with 11 letters...
Phrases (89)
louis leakeyhockey coachglossy snakelike royaltybilly the kidpolicy makermackerel skykeep an eye onalkyl halideclosely knit
...View all with 11 letters...
Words (90)
skullduggerygobbledygookhyperkalemiahyperkineticcheckerberryholidaymakermoneymakingshyperkineseshyperkinesiaheterokaryonhyperlinkinghoneysucklesmonkeyshinesflickeringlymerrymakingskaryokinetichydrocrackedcytoskeletonkeyboardistsleukocytosiscockeyednesscytoskeletalhyperkinesisunremarkablyrekeyboardedhypermarketscockneyfyingleukocytosesdaydreamlikekymographieskremlinologyhydrokineticskyrocketinghypokalemiasjourneyworks
...View all with 12 letters...
Phrases (92)
backspace keylickety splithockey clinichockey leaguejockey shortsrisky venturealben barkleybuckeye stateup to your neckrhesus monkey
...View all with 12 letters...
Words (48)
marketabilitypsychokineticpsychokinesisholidaymakerscytoskeletonsknowledgeablyrekeyboardingmountebankeryphytoplankterhyperkinesiasheterokaryonsmegakaryocytegobbledygookstiddledywinkspsychokineseskindheartedlykinematicallyhydrocrackershe-huckleberrybradykinesiasstickybeakingblackberryingfairnytickleskitty-corneredclickety-clackclickety-clickblockheadedlyjawbreakinglyklyuchevskayahydrokineticsremarkabilitydostoyevskianknickknackeryheartbrokenlyunmistakeably
...View all with 13 letters...
Phrases (91)
el iskandriyahbitter hickoryyakut languagemount mckinleyrobert m. yerkesjekyll and hydeturkey buzzardfactory workerdorothy parkerthree kings' day
...View all with 13 letters...
Words (26)
hyperkeratoticleukodystrophyphytoplanktersankylosaurusesbreathtakinglycockeyednesseshyperkeratoseshyperkeratosisearthshakinglyheterokaryosesheterokaryosisheterokaryoticcantankerouslymegakaryocyticacknowledgedlymegakaryocyteshydrokineticalleukocytosisesblackberry-lilyblackberryingsvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketonekinematographyPhrases (100)
anthony vandykedimethyl ketonedrunken revelryveliky novgorodemergency brakecapital of kenyablackberry bushskeletal systemblended whiskeyold world monkey
...View all with 14 letters...
Words (17)
heartbreakinglykinestheticallyankylostomiasesphenylketonuriccholecystokinintelekineticallyphenylketonuriabrokenheartedlypyknodysostosesknowledgabilitycockneyficationkenogeneticallypoverty-strickenacknowledgeablylymphoblast-likehuckleberryingsdiphenylketonesPhrases (81)
erlenmeyer flaskmask of pregnancyturkey drumstickkeep one's eyes offcapital of turkeyalfred korzybskinetwork topologysecurity blanketandrei tarkovskymonkey-bread tree
...View all with 15 letters...
Words (10)
heterokontophytaleukodystrophieskinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosisescholecystokininskrypterophaneronknowledgeabilityPhrases (68)
strictly speakinghypophyseal stalkfyodor dostoevskifyodor dostoevskycapital of new yorkfriendly takeoverfamily gekkonidaeelwyn brooks whitefeodor dostoevskytrackless trolley
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (33)
aleksandr solzhenitsynsri lankan monetary unitisle royal national parksoren aabye kierkegaardpakistani monetary unitjohn fitzgerald kennedythomas kennerly wolfe jr.sir john cowdery kendrewpresident john f. kennedyschlumbergera buckleyi
...View all with 21 letters...
Phrases (15)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykoaleksey maximovich peshkovfrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneylucy in the sky with diamondsayatollah ruholla khomeini
...View all with 24 letters...
Phrases (18)
francis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskymelville louis kossuth deweypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkovmikhail yurievich lermontov
...View all with 25 letters...
Phrases (12)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventory
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
