Words Containing: K,E,L,L
(In Any Order)
There are 848 words,
990 phrases and
0 abbr's with
K,E,L,L in.
Best Scoring Words With: K,E,L,L
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| bleakly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • without hope | ||||||||
| clerkly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adjective • Of clerks; befitting a clerk. • Scholarly. adverb • In a scholarly manner. | ||||||||
| elflock | 7 | 16 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| kvelled | 7 | 15 | verbv | |||||
verb • To feel delighted and proud to the point of tears; to boast; to gloat. | ||||||||
| inkwell | 7 | 14 | nounn | |||||
noun • a small well holding writing ink into which a pen can be dipped | ||||||||
| lawlike | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| sleekly | 7 | 14 | adverbadv | |||||
adverb • in a sleek glossy manner | ||||||||
| leakily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| owllike | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| elflike | 7 | 14 | adjectiveadj | |||||
adjective satellite • small and delicate | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
kellWords (45)
skilledkendallskilletlikablekelloggukulelegaskellinkwellukelelebleaklykillerslawlikesleeklyknelledknolledkvelledliplikeleakilyskulledclerklykilldeekillieselflockkrullerbelleekskellumowllikeeellikekellieselflikeleglikekleagleknollerkoellialakelet
...View all with 7 letters...
Phrases (1)
milk legWords (139)
unlikelyfolklorerockwelllikeableoverkilllifelikekennellyladylikeskeletalalkalinelakelandfolktalealkalizeshellackclawlikelovelockmilklesslikelierlucklesskeelhaulleaflikekilldeerwolflikealkalisebalklinerakehellsilklikelacelikekillablekvellingbullnecklavalikeleaklessgluelikelakelike
...View all with 8 letters...
Phrases (19)
paul kleeark shellkill zonekerr cellbell booklike hellbell deckbull neckreal talkfolk tale
...View all with 8 letters...
Words (177)
knoxvillechildlikesleepwalkcellblockunskilledunlikablelikeliestjellylikecloudlikekilolitrealkalizershellbarkleechlikebladelikeleafstalkmaplelikesylphlikeoutkilledshellworkwakefullywhalelikeadultlikekilldeersfluidlikeglobelikeclickableclicklessblacklegsgablelikerollickedflamelikesleeplikesnaillikeclothlikealkalized
...View all with 9 letters...
Phrases (43)
little auktank shellkurt weillbulk largeblack biletable talkmilk yieldlake ilmenlake lemanw. k. kellogg
...View all with 9 letters...
Words (137)
basketballlikelihoodpainkillerrecklesslybooksellerlandlockedlacklusterunlikeablegentlefolklacklustrealkalinizelawyerlikeunladylikeweedkillerlukewarmlyneedlelikekennellinghallmarkedwillowlikeunslakablebankrolledbankrollerbullneckedkilolitresyokefellowskeletallytunnellikejackrolledcellblocksvelvetlikeshellackedflowerlikeshellbacksshellbarksleafstalks
...View all with 10 letters...
Phrases (58)
felix kleinpalm kernelklieg lightweed killerliver flukelady killerbelt bucklemusket ballblank shellgrace kelly
...View all with 10 letters...
Words (144)
rockefellerblackmailersleepwalkerfloorwalkeryellowkniferealpolitiklickspittleskepticallysemiskilledknuckleballklinefeltershellackingkilocalorietalkativelymuskellungerathskellerlacklustersbristlelikeblackballedbankrollerslikablenessblacklistedlikelihoodsdislikeableblackmailedyokefellowslobsterliketrellisworkalkalimeterunlikeliestblanketlikealkalimetryleukoplakialeukoplakicleukorrheal
...View all with 11 letters...
Phrases (67)
louis leakeynikola teslaflower stalkalkali metallike royaltyshell jacketbilly the kidalkyl halideclosely knitemmett kelly
...View all with 11 letters...
Words (93)
sleepwalkingjacksonvilleskullduggeryglockenspielendoskeletalknowledgableunlikelihoodunkennellingkilocalorieslikabilitiesflickeringlyskillfulnesstrellisworkslickspittlessleepwalkersalkalinitiesmultiskilledshellackingsbackpedalledcytoskeletalrealpolitikscockleshellsrathskellersknuckleballsleukoplakiasfloorwalkerskremlinologyblacklistersskillessnessblackmailersunlikelinessalkalimetersrockabillieslifelikenessbooksellings
...View all with 12 letters...
Phrases (65)
lickety splitfellow workeredible cocklelurking placealben barkleypull up stakeswilliam blakepickle relishsparkle metalyellow jacket
...View all with 12 letters...
Words (41)
knowledgeablekapellmeistergentlemanlikechameleonlikeknowledgeablyporcelainlikelikablenessesblanketflowerknuckleballerglockenspielschildlikenessalkalimetrieskinematicallyunlikelihoodsshellcrackersbackpedallingrealpolitikerunskilfulnessskilfulnessesclerklinessesclickety-clackclickety-clickblockheadedlyunscholarlikeself-knowledgewinterkillingunsoldierlikespellcheckersfrankliniellaalkalescenceshelter-skeltersleepwalkingsbalderlocksesslockdolagersslockdoligers
...View all with 13 letters...
Phrases (77)
superior skillskeletal framejekyll and hydechicken littlelike clockworkalkaline metalalaska fur sealalexander blokwilkie collinsroller skating
...View all with 13 letters...
Words (24)
skullduggeriesskillfulnesseskapellmeisterslifelikenessesskillessnessesknuckleballersacknowledgedlykremlinologieskremlinologistunlikelinessesblanketflowersunskillfulnessgallsicknessesrealpolitikersblackberry-lilykilovolt-amperealkaline-lovingwinterkillingslucklessnesseslikeablenessesalkalescenciesladylikenessespoikilothermalmallemarokingsPhrases (83)
small livestockskeletal systemold world monkeykwajalein atollskilled workmanbullock's orioleshark repellentartificial lakewilliam crookesslovak language
...View all with 14 letters...
Words (18)
rumpelstiltskinkinestheticallykremlinologistschildlikenessesmusculoskeletalunknowledgeabletelekineticallykaleidoscopicalknowledgabilitykenogeneticallyunskilfulnessesacknowledgeablylymphoblast-likemetallic-lookingacknowledgeableungentlemanlikegranville-barkerrocket-propelledPhrases (86)
in all likelihooddrunken revellererlenmeyer flaskwholesale marketalaskan malamutebokmaal languagekhalkha languagealbizzia lebbeckniels henrik abelruholla khomeini
...View all with 15 letters...
Words (4)
knowledgeablenesskaleidoscopicallyleukoencephalitisgentlemanlikenessPhrases (63)
kiswahili languageswallow-tailed kiteblackfoot languagebuckminster fullereugene curran kellybattle of kwajaleinmary douglas leakeyblack-backed jackalblack-billed cuckoodouble-deck rail car
...View all with 17 letters...
Words (2)
knowledgeablenessesgentlemanlikenessesPhrases (46)
handle with kid glovesalben william barkleydibranchiate mollusktrans-alaska pipelinemickey charles mantleeskimo-aleut languagehard-skinned puffballblack-stem spleenwortprefrontal leukotomywhole kit and caboodle
...View all with 19 letters...
Words (2)
alkylbenzenesulfonatebuckminsterfullerenesPhrases (40)
aleksandr solzhenitsynbillie jean moffitt kingstephen william hawkingsmallmouthed black bassklebs-loeffler bacillusisle royal national parkthomas kennerly wolfe jr.battle of lake trasimenewilliam schwenk gilberterik alfred leslie satie
...View all with 21 letters...
Phrases (16)
louis seymour bazett leakeyrichard buckminster fullerequus caballus przewalskiimax karl ernst ludwig planckblack and gold garden spiderbattledore and shuttlecocknickel-cadmium accumulatorwireless local area networkequus caballus przevalskiihuman t-cell leukemia virus-1
...View all with 24 letters...
Phrases (12)
rudolf christian karl dieseltrans-alaska pipeline systembronislaw kasper malinowskimelville louis kossuth deweymikhail yurievich lermontovislamic republic of pakistanchronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellbruckenthalia spiculifolia
...View all with 25 letters...
Phrases (18)
charlotte anna perkins gilmanchannel islands national parksir sarvepalli radhakrishnanlassen volcanic national parkkarl rudolf gerd von rundstedtemployee stock ownership planfriedrich gottlieb klopstockcockcroft-walton acceleratoralexander alexandrovich blokkeep one's shoulder to the wheel
...View all with 26 letters...
Phrases (19)
director-stockholder relationjerusalem artichoke sunflowersir frederick william herschelaleksandr aleksandrovich blokfalkland islands monetary unitnikolai ivanovich lobachevskyuniversity of nebraska-lincolnwrangell-st. elias national parkhawai'i volcanoes national parkhawaii volcanoes national park
...View all with 27 letters...
Phrases (9)
aleksandr nikolayevich scriabintheodore roosevelt national parklydia kamekeha paki liliuokalanicockcroft and walton acceleratorprince william, duke of cumberlandkendall partial rank correlationbernd heinrich wilhelm von kleistdenali national park and preservevyacheslav mikhailovich molotovPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
enzyme-linked-immunosorbent serologic assay
