Words Containing: INK
(In Exact Order)
There are 733 words,
242 phrases and
1 abbr with
INK in.
Best Scoring Words With: INK
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| zinkify | 7 | 26 | ||||||
Valid word for Scrabble US
| ||||||||
| hijinks | 7 | 21 | nounn | |||||
noun • noisy and mischievous merrymaking | ||||||||
| zinky | 5 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| jinking | 7 | 19 | verbv | |||||
verb • To make a quick evasive turn. • To cause a vehicle to make a quick evasive turn. • In the games of spoilfive and forty-five, to win the game by taking all five tricks; also, to attempt to win all five tricks, losing what has been already won if unsuccessful. • To elude; to cheat. | ||||||||
| chewink | 7 | 19 | nounn | |||||
noun • common towhee of eastern North America | ||||||||
| jinked | 6 | 18 | verbv | |||||
verb • To make a quick evasive turn. • To cause a vehicle to make a quick evasive turn. • In the games of spoilfive and forty-five, to win the game by taking all five tricks; also, to attempt to win all five tricks, losing what has been already won if unsuccessful. • To elude; to cheat. | ||||||||
| jinkers | 7 | 18 | verb, nounv, n | |||||
noun • A high wheeled wagon designed to carry lumber suspended under the body of the vehicle. | ||||||||
| kinkily | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| wrinkly | 7 | 17 | adjectiveadj | |||||
adjective • marked by wrinkles | ||||||||
| chinked | 7 | 17 | verb, adjectivev, adj | |||||
adjective satellite • having narrow opening filled | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
inkWords (119)
sinkingtwinkledrinkerthinkerwrinklerethinkstinkerinklingwrinklytrinketwinkingwinklerblinkerpinkieslinkageratfinkhijinkspinkishinkwellinkblotclinkercrinklepinkeyechinkeddinkiesinklesstinklerkinkiercrinklybethinktwinklylinkboyshrinksoinkingjinking
...View all with 7 letters...
Phrases (9)
fin keeldrink upsea pinkthink upinky capthink ofstink upice rinkdrink inWords (136)
thinkingdrinkingstinkingblinkingwrinkledhelsinkitinklingclinkingsprinklepachinkomethinkssinkholeblinkersoutthinkhoodwinkcufflinkstinkpotcrinkledkinkiestshrinkerslinkingtinkererkinkajoubobolinkoutdrinklinksmanrelinkedtinkeredslinkilythinkerslinkableunlinkedtrinkumstwinkledunkinked
...View all with 8 letters...
Phrases (18)
eye blinkvitamin kdata linkheat sinkpink slipstink outsink plugrock pinkpink winethink out
...View all with 8 letters...
Words (119)
shrinkingtwinklingsprinklessprinklerpinkertonstinkweeddrinkableshrinkageinterlinkthinkableoverdrinkchinkapinunwrinkleslinkiesthyperlinkkinkinessstinkhornsinkholessprinkleddownlinksinkstandsstinkiesttrinketedwrinklierunwinkingrelinkingtinkerersunlinkingtinkeringtwinklersstinkbugsuplinkingblinkeredstinkwoodoutthinks
...View all with 9 letters...
Phrases (26)
high jinksink bottleclove pinkdrink downvitamin k1think backinking padvitamin k3relay linkpen-and-ink
...View all with 9 letters...
Words (92)
painkillersprinklingrethinkingperiwinkleunwrinkledunsinkableunblinkingunthinkingnondrinkerhoodwinkerbethinkingdrinkablesthinkinglyshrinkagesinterlinkshoodwinkedunwrinklestwinklingsblinkeringlinkslandsstinkwoodsinkinessesrethinkersoverthinksstinkerooszinkifyinginkberriesgroupthinksnowblinksshrinkablediesinkerspreshrinksslinkinessstinkinglytinkertoys
...View all with 10 letters...
Phrases (26)
marking inkfruit drinktickle pinkmaiden pinkmixed drinkshrink fromthink twiceforty winkspink familycatch a wink
...View all with 10 letters...
Words (65)
unthinkableundrinkablenondrinkingfreethinkertiddlywinksunthinkablyoutthinkingcountersinkhyperlinkedunwrinklingnonsinkablehoodwinkersinterlinkedhoodwinkingbesprinklespainkillingperiwinklessprinklingsgroupthinkssprinkleredbesprinkledkinkinessesnondrinkerstrinketriesnonthinkingpainkillersoutdrinkingdoublethinkdistelfinksdownlinkingantiwrinklemisthinkingpinkishnesscramboclinkkiddiewinks
...View all with 11 letters...
Phrases (36)
linking verbbeer drinkermissing linkcaptain kiddgene linkagepink diseasecalvin kleinthinking capy-linked geneprinting ink
...View all with 11 letters...
Words (43)
freethinkingheadshrinkerinterlinkingunthinkinglyhyperlinkingunblinkinglyoverthinkingbesprinklingdoublethinkspreshrinkingoverdrinkingthinkingnessbrinkmanshipsprinkleringdrinkabilityslinkinessescountersinksfreethinkersclinker-builtunshrinkablewrinkleprooftiddledywinkfree-thinkingpink-lavendercramboclinksforethinkersoverstinkingcross-linkageunderskinkerstinkingnesslavender-pinkpinkish-whitekiddiewinkiepinnywinklescrinkleroots
...View all with 12 letters...
Phrases (26)
tea-like drinkpurplish pinkblink of an eyeginkgo familythink factorysinking spellstinking irisrip van winklepink bollwormdog stinkhorn
...View all with 12 letters...
Words (20)
brinksmanshipheadshrinkersnonshrinkablepinkishnessesfreethinkingstiddledywinksthinkablenessbrinkmanshipspinkish-orangepinniewinklespinkish-purplechinkerincheeunshrinkinglyginkgophytinaunderskinkersschumann-heinkkiddiewinkiesdrinkablenessclear-thinkingzinkificationPhrases (17)
drinking glassdrinking waterstinking cedardinka languageround of drinkssocial drinkermountain skinkyellowish pinkice-hockey rinkink-jet printer
...View all with 13 letters...
Words (9)
unthinkabilitycountersinkingdrinkabilitiesthinkingnessesbrinksmanshipszinkificationschinkerincheesunthinkingnessstinkingnessesPhrases (18)
stinking wattlepeptide linkagesinking feelingalcoholic drinkwishful thinkerdrinking vesselpink fivecornercountersink bitpink paper daisychainlink fence
...View all with 14 letters...
Phrases (1)
shrink-wrapped softwarePhrases (1)
pink-and-white everlastingPhrases (1)
x-linked dominant inheritancePhrases (1)
x-linked recessive inheritancePhrases (1)
enzyme-linked-immunosorbent serologic assay
