Words Containing: INK
(In Exact Order)
There are 733 words,
242 phrases and
1 abbr with
INK in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| zinkify | 7 | 26 | ||||||
Valid word for Scrabble US
| ||||||||
| hijinks | 7 | 21 | nounn | |||||
noun • noisy and mischievous merrymaking | ||||||||
| zinky | 5 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| jinking | 7 | 19 | verbv | |||||
verb • To make a quick evasive turn. • To cause a vehicle to make a quick evasive turn. • In the games of spoilfive and forty-five, to win the game by taking all five tricks; also, to attempt to win all five tricks, losing what has been already won if unsuccessful. • To elude; to cheat. | ||||||||
| chewink | 7 | 19 | nounn | |||||
noun • common towhee of eastern North America | ||||||||
| jinked | 6 | 18 | verbv | |||||
verb • To make a quick evasive turn. • To cause a vehicle to make a quick evasive turn. • In the games of spoilfive and forty-five, to win the game by taking all five tricks; also, to attempt to win all five tricks, losing what has been already won if unsuccessful. • To elude; to cheat. | ||||||||
| jinkers | 7 | 18 | verb, nounv, n | |||||
noun • A high wheeled wagon designed to carry lumber suspended under the body of the vehicle. | ||||||||
| kinkily | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| wrinkly | 7 | 17 | adjectiveadj | |||||
adjective • marked by wrinkles | ||||||||
| chinked | 7 | 17 | verb, adjectivev, adj | |||||
adjective satellite • having narrow opening filled | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
inkWords (119)
sinkingtwinkledrinkerthinkerwrinklerethinkstinkerinklingwrinklytrinketwinkingwinklerblinkerpinkieslinkageratfinkhijinkspinkishinkwellinkblotcrinkleclinkerpinkeyechinkeddinkiesinklessbethinkcrinklytinklerkinkiertwinklylinkboykinkingblinkedrelinks
...View all with 7 letters...
Phrases (9)
fin keeldrink upice rinkdrink insea pinkthink upinky capstink upthink ofWords (136)
thinkingdrinkingstinkingblinkingwrinkledhelsinkitinklingsprinkleclinkingpachinkomethinkssinkholeblinkersoutthinkhoodwinkcufflinkstinkpotkinkiestcrinkledshrinkerslinkingbobolinktinkererkinkajououtdrinklinksmantwinklerlinkboysratfinksrethinksuplinkedslinkierswinkingchinkingstinkier
...View all with 8 letters...
Phrases (18)
eye blinkvitamin kdata linkindia inkthink outfire pinkmink coatpink ladywild pinkrose pink
...View all with 8 letters...
Words (119)
shrinkingtwinklingsprinklessprinklerpinkertonstinkweeddrinkableshrinkageinterlinkthinkablechinkapinslinkiestunwrinkleoverdrinkhyperlinkkinkinessstinkhornstinkbugsunlinkingtinkeringtwinklerspreshrinkblinkeredstinkwoodoutthinkscrinklinghoodwinksuplinkinginkstandsstinkiestsinkholeswrinklingsprinkleddownlinkstrinketed
...View all with 9 letters...
Phrases (26)
clove pinkdrink downthink backvitamin k1high jinksink bottlegolf linkspink callahard drinkradio link
...View all with 9 letters...
Words (92)
painkillersprinklingrethinkingperiwinkleunwrinkledunsinkableunblinkingunthinkingnondrinkershrinkagesinterlinkshoodwinkedbethinkinghoodwinkerunwrinklestwinklingsthinkinglydrinkablestinkertoysstinkhornshyperlinksbesprinklepinknessesstinkweedsdistelfinkdownlinkedoverdrinkschinkapinscrinkliestclinkeringtrinketerswrinkliestzinkenitessprinklersoverthinks
...View all with 10 letters...
Phrases (26)
maiden pinkmixed drinkshrink fromindian pinkthink twiceforty winkspink familycatch a winkmarking inkfruit drink
...View all with 10 letters...
Words (65)
unthinkableundrinkablenondrinkingtiddlywinksfreethinkeroutthinkingunthinkablycountersinkinterlinkedhoodwinkingbesprinklespainkillinghyperlinkednonsinkablehoodwinkersunwrinklingpainkillersnonthinkingtrinketriesmisthinkingpinkishnessoutdrinkingdoublethinkdistelfinksdownlinkingantiwrinkleperiwinklessprinklingskinkinessesnondrinkersgroupthinkssprinkleredbesprinkledforswinkingpennywinkle
...View all with 11 letters...
Phrases (36)
captain kiddgene linkagebeer drinkerlinking verbmissing linkkitchen sinkdolphin kickinkblot testcottage pinkstinking yew
...View all with 11 letters...
Words (43)
freethinkingheadshrinkerinterlinkingunthinkinglyunblinkinglybesprinklingoverthinkinghyperlinkingslinkinessesthinkingnessbrinkmanshipsprinkleringdrinkabilityfreethinkerscountersinkspreshrinkingdoublethinksoverdrinkingunderskinkerstinkingnesslavender-pinkpinkish-whitekiddiewinkiepinnywinklescrinklerootstiggywinklesforethinkingpennywinklesperjinkitiespinniewinklehead-shrinkertiddleywinkspink-lavendernonthinkingsclinker-built
...View all with 12 letters...
Phrases (26)
blink of an eyeginkgo familytea-like drinkpurplish pinkink cartridgeclinker blockginkgo bilobachinkapin oakclinker brickpink cockatoo
...View all with 12 letters...
Words (20)
brinksmanshipheadshrinkersbrinkmanshipsfreethinkingsnonshrinkablepinkishnessesthinkablenesstiddledywinksginkgophytinaunshrinkinglyunderskinkersclear-thinkingschumann-heinkkiddiewinkiesdrinkablenesspinkish-orangepinniewinkleszinkificationpinkish-purplechinkerincheePhrases (17)
drinking glassdrinking waterred periwinkledrinking strawink-jet printerpink elephantslinkage editorstinking eldermikhail glinkalinker histone
...View all with 13 letters...
Words (9)
unthinkabilitycountersinkingthinkingnessesbrinksmanshipsdrinkabilitieschinkerincheesstinkingnessesunthinkingnesszinkificationsPhrases (18)
wishful thinkersinking feelingalcoholic drinkdrinking vesselstinking wattlepeptide linkagerose periwinklestinking cloverice-skating rinkpink shower tree
...View all with 14 letters...
Phrases (1)
shrink-wrapped softwarePhrases (1)
pink-and-white everlastingPhrases (1)
x-linked dominant inheritancePhrases (1)
x-linked recessive inheritancePhrases (1)
enzyme-linked-immunosorbent serologic assay
