Words Containing: ICA
(In Exact Order)
There are 5,370 words,
2,266 phrases and
2 abbr's with
ICA in.
Best Scoring Words With: ICA
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| taxicab | 7 | 18 | nounn | |||||
noun • a car driven by a person whose job is to take passengers where they want to go in exchange for money | ||||||||
| jicamas | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| jicama | 6 | 17 | nounn | |||||
noun • The edible root of the yam bean, Pachyrhizus erosus, used in salads in Central America. | ||||||||
| exotica | 7 | 16 | nounn | |||||
noun • A genre of American music from the 1950s, characterized by an evocative musical focus on the islands of the South Pacific. | ||||||||
| toxical | 7 | 16 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| picacho | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
| lexical | 7 | 16 | adjectiveadj | |||||
adjective • of or relating to words • of or relating to dictionaries | ||||||||
| lexica | 6 | 15 | adverb, nounadv, n | |||||
Valid word for Scrabble US
| ||||||||
| vicarly | 7 | 15 | adverb, nounadv, n | |||||
Valid word for Scrabble US
| ||||||||
| typical | 7 | 14 | adjectiveadj | |||||
adjective • exhibiting the qualities or characteristics that identify a group or kind or category adjective satellite • of a feature that helps to distinguish a person or thing • conforming to a type | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (207)
americanphysicalchemicalveronicacriticaldelicateindicatededicatetropicaltacticalbiblicalverticalclinicalmysticalsurgicalangelicahandicapmicawberdelicacymythicaljamaicanrusticalnauticalcervicalmedicareclericalamicablevicaragebasilicamedicateatypicalcorticalcorsicanefficacysciatica
...View all with 8 letters...
Phrases (2)
vatican iuric acidWords (350)
politicalbasicallypracticaltechnicaldedicatedclassicalhurricaneidenticalindicatedtypicallyduplicatesyndicateharmonicabarricademagicallyhelveticaskepticalnicaragualogicallyradicallymedicallyeradicatedominicanlubricantumbilicalunethicalintricatemedicatedindicatormusicallyillogicalbotanicalreplicateapplicantimplicate
...View all with 9 letters...
Phrases (16)
bric-a-bracerica jonghumic acidfolic acidnux vomicagenus picaoptic axisiodic acidoleic acidarnica bud
...View all with 9 letters...
Words (525)
medicationphysicallyelectricalhistoricalbiologicalhystericalmechanicalrepublicandedicationdespicableantarcticaindicationcomplicatetragicallytheatricalindicatinggeologicalironicallyimplicateddiabolicalecologicalrhetoricaleconomicalclinicallyverticallycriticallysabbaticaleradicatedfabricatedchemicallysurgicallydelicatelybarricadedapplicableanatomical
...View all with 10 letters...
Phrases (49)
costa ricanglyptic artacetic acidplastic artmedical aidres publicamedical manmexican wargraphic artpicnic area
...View all with 10 letters...
Words (682)
complicatedpracticallytechnicallycertificatecommunicateapplicationsignificanthandicappedpoliticallygeneticallytheoreticalpublicationintoxicatedunificationpredicamentideologicalsymmetricaldrasticallyimplicationfornicationbiochemicalstatisticalpericardialegotisticalfabricationfranticallyparadoxicalevangelicalimpracticalvicariouslynonsensicalpuritanicalreplicationtheologicaleradication
...View all with 11 letters...
Phrases (97)
acrylic acidacademic arttonic accentradical signvena cysticaethical drugvena ovaricamedical examdomestic assvaleric acid
...View all with 11 letters...
Words (783)
specificallysignificancedramaticallyintoxicationmathematicalhypocriticalintoxicatingastronomicalpathologicalhypotheticalhistoricallyeconomicallyinexplicableneurologicalcommunicatedmetaphysicalpurificationromanticallycomplicationastrologicalmythologicalnotificationalphabeticalmodificationverificationdomesticatedhystericallybiologicallyperiodicallycommunicatortechnicalitygeographicalpatheticallymetaphoricalsymbolically
...View all with 12 letters...
Phrases (141)
adenylic acidaspartic acidtartaric acidvertical tailethanoic acidvena gastricametrical unitlarix russicamusical scaleascorbic acid
...View all with 12 letters...
Words (845)
communicationpsychologicalsophisticatedautomaticallyinsignificantcommunicatingtheoreticallyphilosophicaltechnologicalsignificantlystatisticallyjustificationqualificationreunificationclarificationgratificationfantasticallyphysiologicalrealisticallyuncomplicatedarcheologicalcertificationstrategicallyauthenticatedcategoricallyparadoxicallyauthenticatorsarcasticallypetrochemicalmagnificationstereotypicalideologicallychronologicalpontificatingcommunicative
...View all with 13 letters...
Phrases (189)
black americanafrican walnutamerican cressbenzyl radicalgraphic artistmefenamic acidoptical devicemexican hyssopafrican nationpimenta dioica
...View all with 13 letters...
Words (720)
communicationsidentificationpharmaceuticalscientificallyhypotheticallyarchaeologicalsystematicallysophisticationmetaphoricallyclassificationelectronicallymultiplicationdemocraticallyexcommunicatedmathematicallymeteorologicalgeographicallyalphabeticallyecclesiasticalpathologicallyinsignificancedetoxificationcriminologicalornithologicalauthenticationgynaecologicallinguisticallybeautificationsociologicallymetaphysicallytelepathicallyprognosticatorscholasticallydiplomaticallysimplification
...View all with 14 letters...
Phrases (191)
biologic attackamerican plaicearabic alphabetagave americanaarteria cysticasabbatical yeartheatrical roletilia americanageographic areafagus sylvatica
...View all with 14 letters...
Words (561)
psychologicallytechnologicallypersonificationunsophisticatedphysiologicallyphilosophicallyprognosticationanthropologicalexcommunicationchronologicallysynergisticallycontraindicatedindemnificationpharmacologicaluncommunicativediversificationparentheticallyaerodynamicallyamericanizationmicroscopicallyobjectificationtherapeuticallybacteriologicalgastronomicallyincommunicativemicrobiologicaldramaturgicallylackadaisicallyexcommunicatingrecertificationseismologicallyelectrificationcommunicabilitylogarithmicallydemographically
...View all with 15 letters...
Phrases (231)
chemical reactorapplication formbiological clockblue african lilycedrus atlanticabond certificateamerican bugbanesorbus domesticapolitical systemribonucleic acid
...View all with 15 letters...
Words (226)
enthusiasticallydisqualificationautobiographicalcatastrophicallynoncommunicationpsychoanalyticalphylogeneticallythermostaticallyjournalisticallypalaeontologicalpsychobiologicalovercomplicatingpharmaceuticallysurrealisticallymonosyllabicallyunapologeticallyreclassificationnoncommunicativephotographicallybiotechnologicalophthalmologicalbureaucraticallyplicatoperipatuspornographicallyclimatologicallyimpracticalitiesgeomorphologicallatensificationsmonotheisticallynucleophilicallyeschatologicallypsychometricallysaccharificationcolorimetricallyhistoricalnesses
...View all with 16 letters...
Phrases (239)
american footballastronomical unitcapital of jamaicabirth certificateamerican woodcockseleucus i nicatorpolitical machinezoological gardenhistorical recordgenista hispanica
...View all with 16 letters...
Words (145)
telecommunicationbacteriologicallymisidentificationanthropologicallysocioeconomicallyincommunicabilityelectrostaticallythermodynamicallyphilanthropicallymaterialisticallyprobabilisticallyelectromechanicalphotoelectricallyresolidificationsheterotrophicallypharmacognosticalautointoxicationssymmetricalnessesdeterministicallyzoogeographicallyepidemiologicallynationalisticallyoceanographicallyamphitheatricallydialectologicallyhydroelectricallyineradicabilitiescryptographicallyinextricabilitiesphotomechanicallyefficaciousnessesillusionisticallyintercommunicatesparasitologicallytrigonometrically
...View all with 17 letters...
Phrases (234)
african golden wolfchemical mechanismamerican alligatorpolitical platformelectrical contactecumenical councilhypoglycemic agentgenus amphicarpaeapathological statemedical specialist
...View all with 17 letters...
Words (65)
telecommunicationscharacteristicallyoversimplificationtransmogrificationpsychopathologicalsociopsychologicalneuropsychologicalchemotherapeuticalspectrographicallyradiocommunicationsubmicroscopicallyungrammaticalitiessedimentologicallytachistoscopicallyophthalmologicallysemidomesticationsquantificationallymisclassificationsstoichiometricallyimmunopathologicalmisidentificationsovercommunicationspsychobiographicalautobiographicallysupersophisticatedlepidopterologicaloveroptimisticallymetallographicallycommunicablenessesethnomusicologicalhydrometallurgicalunenthusiasticallyintercommunicatingphysiopathologicalpropagandistically
...View all with 18 letters...
Phrases (204)
chemical attractionantilope cervicapraantipsychotic agentamerican revolutionambystoma mexicanumpolitically correctpolitical dissidenthistorical documentexplication de textelogical implication
...View all with 18 letters...
Words (59)
psychophysiologicalcinematographicallychromatographicallyoveridentificationspolyesterificationscytophotometricallypsychotomimeticallyconceptualisticallyextralinguisticallyinterstratificationpseudosophisticatedelectromechanicallysociolinguisticallyclinicopathologicalimpressionisticallyphenomenalisticallyunproblematicalnessanthropomorphicallyexhibitionisticallyglottochronologicalmicrometeorologicalcrosslinguisticallyparthenogeneticallynonrelativisticallyradiopharmaceuticalhistopathologicallyoversimplificationscross-classificationsymptomatologicallyhistoriographicallycommunicativenesseshydrometeorologicalmicroelectronicallytransmogrificationsintercommunications
...View all with 19 letters...
Phrases (144)
agapanthus africanus2-hydroxybenzoic acidneurological diseasemechanical advantagemathematical productmexican monetary unitcampanula divaricataacetylsalicylic acidteacher's certificatephysical composition
...View all with 19 letters...
Words (24)
uncharacteristicallyoverenthusiasticallyneuropsychiatricallyspectrophotometricalmicrophotometricallyradiopharmaceuticalsultramicroscopicallysemiautobiographicalroentgenographicallychemotherapeuticallyinterstratificationspseudosophisticationpsychopathologicallyphotoautotrophicallyneuropharmacologicalexistentialisticallycrystallographicallysyncategorematicallyneurophysiologicallymicropaleontologicalimmunocytochemicallyplethysmographicallyelectrophysiologicalpaleoanthropologicalPhrases (130)
scipio africanus majorsouth american countrycommunication channeleruca vesicaria sativalubricating substancenarthecium americanummechanically skillfulamerican football gamebehavior modificationamerican harvest mouse
...View all with 20 letters...
Words (11)
dendrochronologicallyneuroendocrinologicalantiferromagneticallystereomicroscopicallypsychophysiologicallyelectromyographicallypsychopharmacologicalclinicopathologicallypseudosophisticationspsychotherapeuticallyphotolithographicallyPhrases (96)
speaker identificationtheatrical performancephysical impossibilitypolitical contributiondesoxyribonucleic acidelectrical distributorchemotrophic autotrophphysalis philadelphicastatistical commissionspectroscopic analysis
...View all with 21 letters...
Words (3)
electrophysiologicallyotorhinolaryngologicalspectrophotometricallyPhrases (75)
prunus persica nectarinapartnership certificateleishmaniasis americanapolitical incorrectnessmacrozoarces americanuscentral african republiccapital of central africapositive identificationphysical rehabilitationnicaraguan monetary unit
...View all with 22 letters...
Words (2)
microelectrophoreticallyelectrocardiographicallyPhrases (45)
brassica oleracea botrytismatricaria matricarioidesbrassica oleracea capitataantiarrhythmic medicationfrederic auguste bartholdibrassica oleracea acephalachrysosplenium americanumbiological warfare defenseprunus domestica insititiaeconomic and social council
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (31)
american baptist conventiongreat plains of north americahierarchical data structurebrassica oleracea gemmiferachemical weapons conventionsymphoricarpos orbiculatusveronica anagallis-aquaticaproprietorship certificatecertificate of indebtednesscertified public accountant
...View all with 25 letters...
Phrases (16)
confederate states of americastandard anatomical positionbrassica oleracea gongylodesbotrychium matricariifoliumforce-feed lubricating systemdewey decimal classificationarchaeopteryx lithographicacentropristis philadelphicaunited mine workers of americaostwald's theory of indicators
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (17)
electromechanical transduceramerican revolutionary leadertricyclic antidepressant drugelectronic musical instrumentarchaeological planning frameisobutylphenyl propionic acidplicatoperipatus jamaicensisvenae epigastricae superiorescount alessandro di cagliostrooxidation-reduction indicator
...View all with 27 letters...
Phrases (13)
strategic arms limitation talksdissident irish republican armypyrocephalus rubinus mexicanuscrotalus horridus atricaudatusface-amount certificate companyevangelical and reformed churchpseudopleuronectes americanustunica conjunctiva palpebrarumpersonal identification numberorganization of american states
...View all with 28 letters...
Phrases (1)
economic and social council commissionPhrases (1)
democratic and popular republic of algeriaPhrases (1)
general certificate of secondary educationPhrases (1)
enzyme-linked-immunosorbent serologic assay
