Words Containing: I,T,N,E,Y
(In Any Order)
There are 3,949 words,
3,353 phrases and
0 abbr's with
I,T,N,E,Y in.
Best Scoring Words With: I,T,N,E,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| anxiety | 7 | 17 | nounn | |||||
noun • (psychiatry) a relatively permanent state of worry and nervousness occurring in a variety of mental disorders, usually accompanied by compulsive behavior or attacks of panic • a vague unpleasant emotion that is experienced in anticipation of some (usually ill-defined) misfortune | ||||||||
| jitneys | 7 | 17 | nounn | |||||
noun • a vehicle carrying many passengers; used for public transport | ||||||||
| jitney | 6 | 16 | verb, nounv, n | |||||
noun • a vehicle carrying many passengers; used for public transport | ||||||||
| thymine | 7 | 15 | nounn | |||||
noun • a base found in DNA (but not in RNA) and derived from pyrimidine; pairs with adenine | ||||||||
| kyanite | 7 | 14 | nounn | |||||
noun • a grey or greenish-blue mineral consisting of aluminum silicate in crystalline form; occurs in metaphoric rock, used as a refractory | ||||||||
| naivety | 7 | 13 | nounn | |||||
noun • lack of sophistication or worldliness | ||||||||
| wintery | 7 | 13 | adjectiveadj | |||||
adjective • characteristic of or occurring in winter | ||||||||
| witneys | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
| ethinyl | 7 | 13 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| anytime | 7 | 12 | adverbadv | |||||
adjective • Suitable for any time; not associated with any particular time. adverb • At any time interjection • "you're welcome" in response to "thank you" or "thanks." | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (92)
identityentirelyidentifyeternityegyptiandynamitesilentlyserenityemptyingentiretyuntimelytenacityintentlyenormitysenilitysteinwayvenalityprinteryminutelyinnatelycytokinesnippetyfeminitygentrifyinequitycytosinetyrosineretryingunitedlylinotypecytidineinterlaysynecticyeastingsyndetic
...View all with 8 letters...
Phrases (5)
in the wayin theorytonic keylent lilycity lineWords (237)
certainlytestimonyintegritycertaintyinventoryevidentlynecessityintensitysinceritymentalitysyntheticmaternityviolentlysyndicatepatientlyintenselyitineraryhypnotizeingenuitylongevitypaternityroutinelyobscenitybyzantinesenioritysynthesisnotorietyethnicityindemnitycitizenryintensifyimmensitydentistryhygienistmodernity
...View all with 9 letters...
Phrases (14)
queen cityriver tynetyne rivermike tysonparty linein realityfiat moneythe skinnyskinny tiepetty whin
...View all with 9 letters...
Words (387)
everythingdefinitelyuniversityterrifyinggenerosityfraternityeyewitnessinevitablyhypnotizedinsecurityinfidelitytestifyinginfinitelyinternallyveterinaryintimatelyindirectlysensualityinherentlystationerymistakenlyterminallyencryptionnegativitynegativelydishonestyinnocentlyfemininitydiligentlyneutralitystrychninesyndicatedinequalityostensiblycybernetic
...View all with 10 letters...
Phrases (40)
hindu deityenergy unitline of dutymt. mckinleyunix systemtight moneyiron pyritepyknic typenorse deityeating away
...View all with 10 letters...
Words (578)
personalitydifferentlytechnicallyessentiallycountrysideemotionallypotentiallysensitivitygeneticallyuncertaintysovereigntyidentifyingmomentarilyreactionaryconsistencycontingencyefficientlydehydrationinferiorityspontaneitysensibilityterminologysynthesizerrudimentaryincessantlyconfidentlyextensivelyincorrectlypolytechnicattentivelyimpatientlyinfertilityeventualitycrystallineserendipity
...View all with 11 letters...
Phrases (58)
laying wastesingle entryemily bronteclosely knitdinner partyvena cysticapoint the wayopen societyeternal citycopy editing
...View all with 11 letters...
Words (610)
accidentallyincidentallyevolutionaryindefinitelypassionatelysufficientlypenitentiarygynecologistconsistentlydefinitivelyauthenticityconvenientlystorytellingconstituencyintermediarytechnicalitybiosynthesishypertensionelectrifyingpresbyterianincoherentlypersistentlytheophyllineunilaterallyhypertensivetrigonometrypyrotechnicseccentricityinextricablyinadequatelyconnectivitycongenialityterrifyinglyproficientlyphylogenetic
...View all with 12 letters...
Phrases (120)
staying powermount whitneychinese deityphantasy lifeinquiry agentlienal arterystring theoryrisky venturetennis playernew jerseyite
...View all with 12 letters...
Words (622)
extraordinaryrevolutionaryintentionallyexceptionallyindependentlyinstinctivelyvulnerabilityinterestinglycomplimentaryparliamentaryinadvertentlygynaecologistprecautionarypredominantlyexponentiallyintelligentlyfrighteninglymagnificentlyalternativelynitroglycerineverlastinglyconsecutivelydiscretionaryexpeditionarybiotechnologyunsympatheticinconsistencyconfectioneryintravenouslyindifferentlyinterlocutorydistressinglyunemotionallysensationallyenergetically
...View all with 13 letters...
Phrases (165)
vaginal arterydirect antonymauditory sensemount mckinleyinventory itembrandy snifterspiny anteaterdrimys winterimain entry wordacrylate resin
...View all with 13 letters...
Words (508)
responsibilitysimultaneouslyscientificallycinematographyintellectuallycoincidentallyaffectionatelyelectronicallysentimentalityhypersensitiveunquestionablyintentionalitycytogeneticistinterplanetaryphotosynthesisconfidentiallythermodynamicshyperventilatenitroglycerineexcruciatinglyintermittentlyconservativelyconventionallychemosynthesispsychoneuroticexperimentallynephrotoxicitynarcosynthesisdimensionalityinconvenientlyinsufficientlyconstructivelyunintelligiblyconvertibilityappendicectomy
...View all with 14 letters...
Phrases (198)
field intensitywilliam tyndaledimethyl ketonehigh technologycapital of kenyadrainage systemabstract entityoriental cherrymoral certaintydata encryption
...View all with 14 letters...
Words (409)
confidentialityextraordinarilyinternationallytechnologicallyunintentionallyinstantaneouslyenvironmentallyinappropriatelyanaesthesiologyconscientiouslysynergisticallyinaccessibilityintellectualityparentheticallyplenipotentiaryproportionatelymaneuverabilityinfinitesimallyinstrumentalityinvulnerabilitycontroversiallycompassionatelyuncomplimentarymethylphenidaterecrystallizingphotosynthesizeintrospectivelyunparliamentaryuninterruptedlyunacceptabilitydemonstrativelyunquestioninglydispassionatelyheartbreakinglyinconsiderately
...View all with 15 letters...
Phrases (263)
stay of executionbenefit of clergyalimentary pastefamily tinamidaeby trial and errorwassily leontiefsolemnity of marystonecrop familyrationalise awayrhythmic pattern
...View all with 15 letters...
Words (176)
enthusiasticallyindiscriminatelyirresponsibilitytriphenylmethanehyperintelligentunpredictabilityhyperventilationquintessentiallyphylogeneticallynonrevolutionaryunapologeticallyincontrovertiblythrombocytopeniahypersensitivityinconceivabilityconversationallyneuropsychiatrichypersalivationsinextinguishablyparamagneticallytrinitroglycerincommensurabilityhypersensitizingnoncompetitivelyinexhaustibilityunostentatiouslyhyperstimulatinghyperstimulationadministrativelyantiunemploymenthyperventilatinghypervitaminosesthrombocytopenicindiscernibilitymonotheistically
...View all with 16 letters...
Phrases (282)
tympanic membranein a beastly manneritalian greyhoundstrictly speakingchristian huygensdefinite quantityin an elaborate wayefficiency expertvariable quantitynevil shute norway
...View all with 16 letters...
Words (123)
counterinsurgencyunconventionalitysuperconductivityneurophysiologistthermodynamicallyinconsequentiallyinterdisciplinaryantirevolutionaryself-contradictoryisoelectronicallyunexchangeabilityspondylolisthesishyperstimulationshyperventilationshypnotizabilitiesthrombocytopeniaschlortetracyclinemonosyllabicitiespaternalisticallyhyposensitizationarchitectonicallyferrimagneticallymorphogeneticallyunderstandabilitycryopreservationscryptocrystallineencephalomyelitispostrevolutionarymicropaleontologylymphadenopathieshyperalimentationcounterfactualitycytopathogenicitymacroevolutionaryuncontroversially
...View all with 17 letters...
Phrases (302)
mary leontyne pricebalaena mysticetusczech monetary unitproteolytic enzymehypoglycemic agentcuban monetary unitinterstate highwaypearly everlastingcapital of kentuckycylinder separator
...View all with 17 letters...
Words (63)
disproportionatelyinconsequentialityhyperaldosteronisminterchangeabilityhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationpolyribonucleotidesphygmomanometrieshypophysectomizinghyposensitizationsanthropocentricitycylindrical-stemmedtriphosphopyridineimmunocytochemicaldiethylmalonylurearecrystallizationscounterintuitivelymagnetostrictivelydehydrochlorinateddehydrochlorinatestrichloroethylenesgranulocytopoiesesgranulocytopoiesispolypropenonitrileaerothermodynamicsneurophysiologistsrepresentationallyneuropsychiatristsultracentrifugallyneuropsychologistsdemythologizationsmethylprednisoloneincommensurability
...View all with 18 letters...
Phrases (309)
revolutionary groupadministrative bodydame sybil thorndikeeriobotrya japonicalachrymal secretionafghan monetary unitnavigational systemcolumbia universitymetric capacity unitantipsychotic agent
...View all with 18 letters...
Words (52)
cinematographicallypolyesterificationshypersensitizationsextralinguisticallypolyribonucleotideshypolipoproteinemiaparthenogeneticallynonrelativisticallycytodifferentiationconceptualisticallycytopathogenicitiesimmunocytochemistrymagnetohydrodynamicphenomenalisticallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedinterconvertibilityinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionalityinterferometricallyhysterosalpingogramthree-dimensionalityimpressionisticallymethylprednisolonesdeoxyribonucleotideanthropocentricallyelectroretinographyincomprehensibilitymicroelectronically
...View all with 19 letters...
Phrases (312)
water-plantain familyjohn millington syngeitalian monetary unithydrastis canadensislatvian monetary unitalpine type of glaciergiles lytton stracheyphytolacca americanazairese monetary unitzambian monetary unit
...View all with 19 letters...
Words (26)
counterrevolutionaryuncharacteristicallyoverenthusiasticallytetrahydrocannabinolhypersensitivenessespolyphiloprogenitivehyperadrenocorticismcytodifferentiationsimmunocytochemicallymagnetofluiddynamicsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneuropsychiatricallyhyperlipoproteinemiamagnetohydrodynamicsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryroentgenographicallyencephalomyocarditissyncategorematicallydimethylnitrosaminesexistentialisticallyPhrases (251)
william stanley jevonshonduran monetary unitmalawian monetary unitlebanese monetary unitdivision tracheophytahundred-and-forty-fifthbalance sheet analysisbenjamin henry latrobeuniversity of nebraskamilton snavely hershey
...View all with 20 letters...
Words (6)
immunocytochemistriesacetylcholinesterasesotorhinolaryngologiesintersubstitutabilityantiferromagneticallytetrahydrocannabinolsPhrases (197)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unitbulgarian monetary unithungarian monetary unitsri lankan monetary unitextrauterine pregnancybyzantine architecturetanzanian monetary unit
...View all with 21 letters...
Words (3)
intercomprehensibilityhexamethylenetetramineencephalomyocarditisesPhrases (193)
venezuelan monetary unitlycopersicon esculentumredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forcehigh-density lipoprotein
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (129)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisparis-sorbonne universityinterlocutory injunctionkyrgyzstani monetary unitbangladeshi monetary unitsouth korean monetary unit
...View all with 23 letters...
Words (3)
laryngotracheobronchitishyperbetalipoproteinemiaphosphatidylethanolaminePhrases (93)
carnegie mellon universitysubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinunidentified flying objectprivately held corporationsir terence mervyn rattigandistinguished flying crossantiarrhythmic medicationfluoxetine hydrocholoride
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (86)
francis scott key fitzgeraldcentral intelligence agencyedmund john millington syngereligious society of friendsbeggar-my-neighbour strategytrans-alaska pipeline systempyotr alexeyevich kropotkinsir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (59)
hunting and gathering societysecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitationsubdivision deuteromycotinasystem of weights and measures
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (52)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commissiondeoxyadenosine monophosphatetricyclic antidepressant drugdeoxythymidine monophosphate
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (44)
revolutionary people's struggletriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngercardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist league
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (28)
business environmental analysisacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unit
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (29)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (19)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armont
...View all with 31 letters...
Phrases (18)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory druguniversity of california at berkeleytheory of electrolytic dissociationlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensis
...View all with 32 letters...
Phrases (17)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapy
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (9)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (10)
university of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicine
