Words Containing: I,S,K,Y
(In Any Order)
There are 555 words,
484 phrases and
0 abbr's with
I,S,K,Y in.
Best Scoring Words With: I,S,K,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
whiskey | 7 | 20 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
whisky | 6 | 19 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
skivvy | 6 | 19 | noun, adjectiven, adj | |||||
noun • a female domestic servant who does all kinds of menial work | ||||||||
kitschy | 7 | 19 | adjectiveadj | |||||
adjective satellite • effusively or insincerely emotional | ||||||||
hickeys | 7 | 19 | verb, nounv, n | |||||
noun • a small inflamed elevation of the skin; a pustule or papule; common symptom in acne • a temporary red mark on a person's skin resulting from kissing or sucking by their lover | ||||||||
skyphoi | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
shticky | 7 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
sickbay | 7 | 18 | noun, adjectiven, adj | |||||
noun • (nautical) a room for the treatment of the sick or injured (as on a ship) | ||||||||
skydive | 7 | 18 | verbv | |||||
verb • jump from an airplane and perform various maneuvers before opening one's parachute | ||||||||
kylikes | 7 | 18 | nounn | |||||
noun • An Ancient Greek drinking cup with a stem, two handles, and a broad, shallow body | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (65)
whiskeyskylineshakilybrisklykitschysickbaysoymilkskydivetricksyshriekyslicklydisyokekylikesskylikesulkilysnakilysilkilypeskilyspikilybeyliksskysailkidneyspyknicsskidwaymickeyskyanisedinkeysduskilymisyokeriskilyhickeysskyphoimuskilydickeyshuskily
...View all with 7 letters...
Phrases (4)
sick paystick bywhisk bysky diveWords (80)
skylightjoysticksukiyakiskydivernijinskysikorskysneakilykyphosisrakishlyspookilykolinskywhiskeryskimpilydisyokedyuckiestslinkilyswankilyyukkiestkilljoysskydivedwickyupsskylinesfriskilylinkboyssmirkilysickbaysstockilyhayrickseyewinkssnarkilykatydidsenskyingskidwaysfolksilykielbasy
...View all with 8 letters...
Phrases (9)
inbus keyyak's milkstink flyshift keycity desksilky elmsilky oaksoya milksky pilotWords (100)
yorkshireskydivingbuttinskykeynesianwyszynskiyardstickkandinskyskilfullyskywriterankylosismawkishlyknavishlysylphlikepuckishlyyuckinessskydiverskaffiyehsmonkeyishsyruplikeirksomelywalkyriesnonstickyhawkishlyteriyakisgawkishlykeffiyahskeffiyehsjoysticksweakishlykayakingskyanisingdisyokingphysickedsketchilystreakily
...View all with 9 letters...
Phrases (12)
say hey kidmike tysonstrike paytipsy cakecandy kissthe skinnyskinny tiewhisk awaysticky bunsticky end
...View all with 9 letters...
Words (101)
mistakenlyshockinglystravinskyskillfullyfreakishlystrikinglyskywritingspankinglydyskinesiatrotskyitetrickishlyprankishlykanamycinsdyskineticpiggybacksskylightedsneakinglybrickyardsyardsticksskittishlyhyperlinksdoohickeyscockneyishcockneyismphysickingskybridgesskydivingsshylockingticklishlykilocyclessemiweeklyskyjackingskylarkingflunkyismsskysurfing
...View all with 10 letters...
Phrases (18)
isle of skyefloppy disktake it easyforty winksplay tricksalkyd resinkansas citycorn whiskyroy wilkinsmalt whisky
...View all with 10 letters...
Words (66)
tchaikovskybaryshnikovpersnicketymonkeyshinekinesiologykeyboardistsickeninglyskepticallytiddlywinksyastrzemskikeystrokingflyspeckingbricklayerskaryogamiesalkylationscytokinesesplaymakingsbradykininscockneyfiesdyskinesiascockneyismsyuckinessesstringybarklymphokinesskyjackingsbrainsicklylickerishlyskywritingsmythmakingskaryologieskittenishlycytokinesischelyabinskspiny-backedkyanisation
...View all with 11 letters...
Phrases (27)
louis leakeyclosely knitdirty trickscelery stickmaksim gorkywhiskey neatwhiskey sourhockey sticktahoka daisyloosely knit
...View all with 11 letters...
Words (53)
unmistakablystanislavskymoneymakingshyperkineseshyperkinesiaunskillfullymonkeyshinesmerrymakingsbricklayingskeyboardistsleukocytosishyperkinesisstringybarkskymographiesskyrocketinghypokalemiastracklayingskaryokineseskitschifyingkaryokinesiskeyboardingsgallygaskinspinnywinklesbradykinesiakyanisationsstickybeakedkeystrokingskyanizationsblackish-grayblackish-greycockyleekiesstravinskyangreyish-blackkeynesianismtiddleywinks
...View all with 12 letters...
Phrases (25)
body stockinglickety splitshaking palsyrisky ventureboris spasskyalfred kinseyigor sikorskyswamp hickorysoaking syrupturk's cap-lily
...View all with 12 letters...
Words (20)
painstakinglypsychokineticpsychokinesisholidaymakershyperkinesiastiddledywinkspsychokinesesunshrinkinglybradykinesiasstickybeakingfairnytickleshydrokineticsdostoyevskianunmistakeablyankyloglossiakenyapithecussketchabilitykinesitherapykeratomycosispsychometrikaPhrases (27)
el iskandriyahthree kings' daynylon stockingdiospyros kakibanking systemrayon stockingwhiskey bottlesilky wisteriaryukyu islandsmollusk family
...View all with 13 letters...
Words (10)
hyperkeratosisearthshakinglyheterokaryosishydrocrackingsleukocytosisesblackberryingsvelvety-skinnedyekaterinoslavladylikenessesrimsky-korsakovPhrases (44)
igor stravinskyblended whiskeyemily dickinsonturkey stuffingdynamic speakersouth yorkshirehenry kissingercyrus mccormickbishop berkeleysleepy sickness
...View all with 14 letters...
Words (11)
lackadaisicallykinestheticallyankylostomiasesankylostomiasischolecystokininpyknodysostosispoverty-strickenlymphoblast-likehuckleberryingsdiphenylketonesbrachypinakoidsPhrases (38)
turkey drumstickalfred korzybskisecurity blanketandrei tarkovskywilliam shockleygenus myxinikelahydraulic brakessprinkler systemsour mash whiskeyfrancis scott key
...View all with 15 letters...
Words (7)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosisescholecystokininsPhrases (29)
strictly speakingfyodor dostoevskielwyn brooks whiteassyrian akkadianpresident kennedyrodya raskolnikovsnowy tree cricketwassily kandinskiwassily kandinskyproperly speaking
...View all with 16 letters...
Phrases (13)
igor fyodorovich stravinskyfrancis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systemandrei arsenevich tarkovskymelville louis kossuth deweypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkovchamaecyparis nootkatensis
...View all with 25 letters...
Phrases (10)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolneysenck personality inventorymartin luther king jr's birthdaykepler's law of planetary motionPhrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay