Words Containing: I,S,K,E,Y
(In Any Order)
There are 280 words,
370 phrases and
0 abbr's with
I,S,K,E,Y in.
Best Scoring Words With: I,S,K,E,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
whiskey | 7 | 20 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
hickeys | 7 | 19 | verb, nounv, n | |||||
noun • a small inflamed elevation of the skin; a pustule or papule; common symptom in acne • a temporary red mark on a person's skin resulting from kissing or sucking by their lover | ||||||||
skydive | 7 | 18 | verbv | |||||
verb • jump from an airplane and perform various maneuvers before opening one's parachute | ||||||||
kylikes | 7 | 18 | nounn | |||||
noun • An Ancient Greek drinking cup with a stem, two handles, and a broad, shallow body | ||||||||
skylike | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
mickeys | 7 | 18 | nounn | |||||
noun • (ethnic slur) offensive term for a person of Irish descent | ||||||||
shrieky | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
dickeys | 7 | 17 | nounn | |||||
noun • a small third seat in the back of an old-fashioned two-seater • a man's detachable insert (usually starched) to simulate the front of a shirt adjective satellite • (British informal) faulty | ||||||||
peskily | 7 | 16 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
beyliks | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (34)
skydiversneakilywhiskerydisyokedyuckiestyukkiestskydivedskylineseyewinksenskyingkielbasykyanisedkyanisesdisyokeskyaniteswhiskeyskyanizesmisyokedmisyokesskydivesbikewayssnickeryyokelishyolkiestskywriteskitterysickerlypinkeyeskeylinesskieyestsakiyehsyoicksedyoicksesmiskeyedPhrases (4)
inbus keyshift keycity desksilky elmWords (41)
yorkshirekeynesianskywritersylphlikeyuckinessskydiverskaffiyehsmonkeyishsyruplikeirksomelywalkyriesteriyakiskeffiyahskeffiyehsweakishlyphysickedsketchilystreakilyskybridgekilobytesyeastlikejockeyishkryoliteseyeblinksskywriteseuryokiespalsylikevalkyriessqueakilysatyrlikepeckishlycytokinesscreakilyflystrikekyrielles
...View all with 9 letters...
Phrases (8)
say hey kidmike tysonstrike paytipsy cakethe skinnyskinny tiesticky endrye whiskyWords (44)
mistakenlyfreakishlydyskinesiatrotskyitedyskineticskylightedsneakinglyhyperlinksdoohickeyscockneyishcockneyismskybridgeskilocyclessemiweeklyskywritersskywrittenkindlesslyhokypokiestinkertoyswykehamistdisk-jockeykeystoningstickybeakscythelikehackneyismsneakishlyflystrikeskyphosidaemonkeyismsspeakinglyflunkeyishflunkeyismhysterickyjockeyismssyndetikon
...View all with 10 letters...
Phrases (8)
isle of skyetake it easyalkyd resinsleepy dickwhiskey jugwhisky neatsafety bikerye whiskeyWords (43)
persnicketymonkeyshinekinesiologykeyboardistsickeninglyskepticallyyastrzemskikeystrokingflyspeckingbricklayerskaryogamiescytokinesescockneyfiesdyskinesiascockneyismsyuckinesseslymphokineslickerishlykaryologieskittenishlycytokinesischelyabinskspiny-backedstickybeaksteknonymieswhiskeyfiedhackneyismsturkey-sizedgreyish-pinkflunkeyismsshriekinglymistakeablyjockeyshipsdickeybirdsthelytokies
...View all with 11 letters...
Phrases (19)
louis leakeyclosely knitcelery stickwhiskey neatwhiskey sourhockey stickloosely knitstinking yewcorn whiskeymalt whiskey
...View all with 11 letters...
Words (34)
moneymakingshyperkineseshyperkinesiamonkeyshinesmerrymakingskeyboardistsleukocytosishyperkinesiskymographiesskyrocketinghypokalemiaskaryokineseskaryokinesiskeyboardingspinnywinklesbradykinesiastickybeakedkeystrokingsblackish-greycockyleekiesgreyish-blackkeynesianismtiddleywinkspennywinkleskoussevitzkyladylikenessfernyticklespoikilocytesskinny-dipperlocksmitherychimneystacktiggywinkleskidney-shapedquicksilveryPhrases (13)
lickety splitrisky venturealfred kinseyirish whiskeykey signatureslippery dickspider monkeyyorkshire fognew york striprayleigh disk
...View all with 12 letters...
Words (17)
psychokineticpsychokinesisholidaymakershyperkinesiastiddledywinkspsychokinesesbradykinesiasstickybeakingfairnytickleshydrokineticsdostoyevskianunmistakeablykenyapithecussketchabilitykinesitherapykeratomycosispsychometrikaPhrases (19)
el iskandriyahthree kings' daybanking systemwhiskey bottlesilky wisteriayellowish pinkgenus boykiniablended whiskysiberian huskyorkney islands
...View all with 13 letters...
Words (8)
hyperkeratosisearthshakinglyheterokaryosisleukocytosisesblackberryingsvelvety-skinnedyekaterinoslavladylikenessesPhrases (32)
blended whiskeyemily dickinsonturkey stuffingdynamic speakersouth yorkshirehenry kissingerbishop berkeleysleepy sicknessmonkey businessstanley kubrick
...View all with 14 letters...
Words (7)
kinestheticallyankylostomiasescholecystokininpoverty-strickenlymphoblast-likehuckleberryingsdiphenylketonesPhrases (31)
turkey drumstickalfred korzybskisecurity blanketandrei tarkovskywilliam shockleygenus myxinikelahydraulic brakessprinkler systemsour mash whiskeyfrancis scott key
...View all with 15 letters...
Words (7)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosisescholecystokininsPhrases (21)
strictly speakingfyodor dostoevskielwyn brooks whitepresident kennedysnowy tree cricketproperly speakingbenjamin kubelskywhite honeysuckleshellbark hickorypeter tchaikovsky
...View all with 16 letters...
Phrases (12)
francis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systemandrei arsenevich tarkovskymelville louis kossuth deweypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkovchamaecyparis nootkatensiscommunist party of kampuchea
...View all with 25 letters...
Phrases (10)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolneysenck personality inventorymartin luther king jr's birthdaykepler's law of planetary motionPhrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay