Words Containing: I,S,H,E,E,S
(In Any Order)
There are 2,632 words,
1,752 phrases and
0 abbr's with
I,S,H,E,E,S in.
Best Scoring Words With: I,S,H,E,E,S
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| seiches | 7 | 12 | nounn | |||||
noun • a wave on the surface of a lake or landlocked bay; caused by atmospheric or seismic disturbances | ||||||||
| heiress | 7 | 10 | nounn | |||||
noun • a female heir | ||||||||
| hessite | 7 | 10 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (47)
sightseesheepishsheeniesheirlessesthesiaesthesissweetishsherriesfetishesinmeshesheisterschemisesrelishesdehiscessevichessheltiesreshinesfisheyeshidelessshrievessteepishpheresishessiteshivelessperishesmeshiestheresiesimmeshesasheriesbeshineseddishesechoisesschemiesmishmeesbhistees
...View all with 8 letters...
Words (143)
shoeshinefisheriesemphasisewhitenesssheepskinheavinessheterosissightseerestheticsephesiansapheresislithenessheftinessflemishesfleshiestadhesivestheorisesevanishesphariseesinspheresblemishesshoresideshieldersshivareeschiselersdishevelsshivererssightseensightseeshipnessesepiphysessheetingschewinesshomesitesheiresses
...View all with 9 letters...
Phrases (2)
side horseset chiselWords (216)
anesthesiaaestheticsweightlessfirehousessynthesizesheepishlyjewishnessberkshiressynthesiseemphasisedsinghalesecheekinesshesperideschoicenesshiddennessmetathesistetchinessshellfiresantithesesinsheathesholinessesepenthesisshoeshinesmethodisestilefishesprophesiesreshipperswhisperersrepolishesshowpiecesoverfisheseldershipsbesmirchescherishersbiospheres
...View all with 10 letters...
Phrases (8)
chess pieceshire horsesheet musicbest wishesseed shrimptennis shoeswedish ryesixth senseWords (380)
establishedhairdressersightseeingselfishnesssmithereenssynthesizeranaesthesiareestablishanesthetistsynesthesiasynthesizedparenthesistheirselvesschlesingerhealthinessshirtsleevestealthiesthyperemesiskinesthesiatrusteeshipheinousnesssightednesshideousnessshrubberiessynthesiserhemopoiesishirsutenesshurriednesspettishnessweightinesswealthinesspeevishnessshellfisheschemistriesshininesses
...View all with 11 letters...
Phrases (18)
charles ivesfish speciesteleost fishbessie smithfisheye lenssingle shellirish setterchinese shando the dishesswiss cheese
...View all with 11 letters...
Words (449)
headmistresswestinghousehomesicknessanaestheticsanaesthetisthorriblenessrhinocerosesaestheticismweightlesslysceneshifteranaesthetiseoveremphasisshrewishnesschastisementcohesivenessshirtsleevesparaesthesiasynaesthesiadevilishnesssheepishnessthievishnessstealthinessfeverishnessmotherlinessfatherlinessadhesivenessapotheosizesheavenlinessflashinesseshyperkineseshypothesizescuttlefisheslavishnessessphericitiescandlefishes
...View all with 12 letters...
Phrases (33)
chinese aniseshepherd's piescottish reelhoosier statestage whisperspear thistlechinese goosewhite cypresstreasure shipchristmas eve
...View all with 12 letters...
Words (476)
establishmentrighteousnessthoracentesistortoiseshellfaithlessnesselephantiasisshakespearianpigheadednessunselfishnessmorphogenesissqueamishnesspresidentshiphabitablenesscrotchetinesshematopoiesishyperhidrosesuprightnessesstylishnessesinheritresseslengthinessesspeechwritersreestablishedreestablishesphalansterieshaughtinessesdelightednessnaughtinessesweightinessesheadshrinkerspiggishnessesovernourishesherpesviruseswaspishnessesimperishablestelegraphists
...View all with 13 letters...
Phrases (69)
white asbestosgenus anthemischristmas treegenus haemopishenri rousseauspanish peopleacipenser husogenus mephitisdomestic sheepselfish person
...View all with 13 letters...
Words (376)
hypersensitivecholinesterasechemosynthesisweightlessnessmetempsychosisphotosensitivemephistophelesworcestershireheadmastershipdisenfranchisemechanicalnesshospitablenessfarsightednessneighborlinessanesthesiologyservomechanismcoquettishnessnewsworthinessthriftlessnessmethodicalnesssnobbishnessescomprehensionsreestablishingdelightfulnessadhesivenesseshemerocallisesheadmistresseshemicellulosesnoteworthinessworthwhilenesseuphoniousnesswatertightnessbronchiectasesinchoatenessesrehospitalizes
...View all with 14 letters...
Phrases (77)
ischemic strokefisherman's lurefishing licensechinese parsleydistorted shapegenus hamamelisjapanese radishgenus delphinusspeech disorderhenry kissinger
...View all with 14 letters...
Words (256)
disenfranchisedanaesthesiologymisapprehensionparthenogenesiselectrophoresisforesightednessgloucestershirestereochemistryphotosynthesizeunrighteousnessmischievousnesslightheadednessnearsightednessatherosclerosiskindheartednesstightfistednessblameworthinesshypersensitizedreestablishmentphotosensitizedunsightlinessesunderemphasizesfashionablenesspigheadednessesfoolhardinessesprohibitivenesschildlessnesseschildlikenessesdisheartenmentshyperaggressiveimpoverishmentsservomechanismsuninhibitednessstoichiometrieshyperstimulates
...View all with 15 letters...
Phrases (126)
high renaissancesir john herschelsystem of weightssnake in the grassshel silversteinchemical processfriedrich bessellymphatic vesselgenus chordeilesgenus phragmites
...View all with 15 letters...
Words (102)
anesthesiologistshortsightednesshypersensitivityoverenthusiasticlightheartednessmiscomprehensionradiochemistrieshypersensitizingthermoperiodismshypersexualitiespraiseworthinessunneighborlinesshypersusceptiblehyperviscositieshypervitaminosesthriftlessnessesfarsightednesseshypophysectomieshypophysectomisearchiepiscopatesleukodystrophiessprightfulnessesimperishablenesssteprelationshipnoteworthinessesforthrightnessesstretchabilitiespetrochemistriesreestablishmentsold-fashionednessanti-aestheticismphenomenologistswatertightnessesestablishmentismweightlessnesses
...View all with 16 letters...
Phrases (135)
president johnsonchristmas diseasechristmas presentgenus cheilanthesgenus cheiranthusgenus epinephelusmechanical stressmechanical systemoscar hammersteingenus phoenicurus
...View all with 16 letters...
Words (63)
comprehensivenessmiscomprehensionsspectroheliogramsspectrohelioscopekindheartednessesdisestablishmentsdisfranchisementsinheritablenessesthermostabilitiescrashworthinessesfashionablenesseshypophysectomizesunrighteousnessesarchconservativestightfistednesseshypophysectomisedstandoffishnessesstereochemistriesmachine-accessiblelongsightednessesimmunochemistriesauthoritativenessforesightednessespharisaicalnessesnearsightednessesbiogeochemistriesimperishabilitiesphosphodiesteraseblameworthinessesreprehensiblenesstrustworthinessesneurophysiologiesneuropsychiatriesneuropsychologiessuperheavyweights
...View all with 17 letters...
Phrases (168)
hashimoto's diseasejacques tatischefftheological systemerithacus svecicusdianthus deltoidespetasites hybridusgenus phalaenopsishexadecimal systemgenus acridotheressinhalese language
...View all with 17 letters...
Words (48)
hyperaldosteronismdisenfranchisementhypersensitivenesshypersensitivitieshypersensitizationspectroheliographsthermoplasticitiesspectrohelioscopesinharmoniousnessesinhospitablenessesdishonorablenessesfaintheartednessespsychotherapeuticsapprehensivenessessphygmomanometriesarchaeoastronomiescreditworthinesseslightheartednessescomprehensiblenesspraiseworthinessesaustralopithecinesdiethylstilbestrolcharacteristicnesselectrochemistriesdehydrochlorinasesmechanochemistriesimperishablenessesphosphodiesterasesreprehensibilitiesotherworldlinessesbloodthirstinessesanticholinesterasephotodisintegrateschemiluminescencesinterrelationships
...View all with 18 letters...
Phrases (154)
theodosius the greatclass schizomycetessir matthew flinderspolianthes tuberosagenus chamaecytisusgeorge westinghouseascension of the lordtomistoma schlegelisir william herscheloscar hammerstein ii
...View all with 18 letters...
Words (27)
thermoluminescencesdisenfranchisementshypersensitizationshypersusceptibilityspectrophotometriescomprehensibilitiescomprehensivenessesstereophotographiesauthoritativenessesdiethylstilbesteroldiethylstilboestrolreprehensiblenesseshemidemisemiquaversmethylprednisoloneselectrophysiologieselectrophysiologistanticholinesterasesgood-neighbourlinessphotoreconnaissancepseudosophisticatedhydrometeorologistsestablishmentariansdiethylstilbestrolsethnomethodologistsinterchangeablenessunfashionablenessesinexhaustiblenessesPhrases (126)
giles lytton stracheyhelianthus tuberosuspounds per square inchhydrobates pelagicustragelaphus imberbisworcestershire saucemathematical processsecondary censorshiptrichopterous insectcapital of seychelles
...View all with 19 letters...
Words (18)
overenthusiasticallyhypersensitivenessesspectroheliographiescomprehensiblenessesphiloprogenitivenessacetylcholinesteraseelectrophysiologistsincomprehensiblenessmicroelectrophoresesmicroelectrophoresispseudocholinesteraseantiestablishmentismphotoreconnaissancesnephroangiosclerosishyperconsciousnessesdimethylnitrosaminesheterobasidiomycetesirreproachablenessesPhrases (129)
suborder strepsirhinigilbert charles stuartbusiness relationshipstephen collins fosterbalance sheet analysissagittarius the archersphenisciform seabirdneisseria gonorrhoeaemilton snavely hersheychristopher isherwood
...View all with 20 letters...
Words (14)
disestablishmentarianhypersusceptibilitiesimmunocytochemistriesstraightforwardnessesimmunoelectrophoresesestablishmentarianisminterchangeablenessesacetylcholinesterasespseudohermaphroditismimmunoelectrophoresisincomprehensibilitiespseudocholinesteraseshypercholesterolemiasindistinguishablenessPhrases (122)
sir john everett millaiscercopithecus aethiopsaleksandr solzhenitsynanthriscus cereifoliumphascolarctos cinereusarithmetic progressionsamuel dashiell hammettequus hemionus hemionusintravenous anestheticarmed forces censorship
...View all with 21 letters...
Words (6)
disestablishmentariansimmunohistochemistriesphiloprogenitivenessesincomprehensiblenessesencephalomyocarditisesestablishmentarianismsPhrases (99)
haliaeetus leucorhyphusleishmaniasis americanaaleksandr i. solzhenitsyninstrument of punishmentbattle of the bismarck seafriedrich wilhelm besselarthur meier schlesingergotthold ephraim lessingengraulis encrasicholusadenosine monophosphate
...View all with 22 letters...
Words (2)
indistinguishablenessesmicrospectrophotometersPhrases (66)
parenthetical expressiontransient ischemic attackhippoglossus stenolepsisaristolochia serpentariahenri emile benoit matissetyrosine kinase inhibitorrichard brinsley sheridancervus elaphus canadensisepinephelus adscensionissearch and destroy mission
...View all with 23 letters...
Words (3)
intercomprehensibilitiesmicrospectrophotometriesschizosaccharomycetaceaePhrases (75)
argyroxiphium sandwicenseprimary sex characteristicbattle of the spanish armadabrassica oleracea acephalaarthur meier schlesinger jr.existentialist philosophyhypersensitivity reactioncharles augustus lindberghcharles camille saint-saensalgernon charles swinburne
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesantiestablishmentarianismPhrases (59)
battle of the chemin-des-damescruel and unusual punishmentdistinguished service medalboris leonidovich pasternakmodest petrovich mussorgskyrudolf christian karl dieselwar of the spanish successionherpes simplex encephalitissir arthur stanley eddingtonandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (47)
helen maria fiske hunt jacksonfrances eliza hodgson burnettnational institutes of healthwar of the austrian successionjames abbott mcneill whistlerherpes varicella zoster virusemployee stock ownership plansir charles scott sherringtonunited nations children's fundparthenocissus quinquefolia
...View all with 26 letters...
Phrases (35)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginfreedom from search and seizurejerusalem artichoke sunflowerdeoxyadenosine monophosphatecryptobranchus alleganiensistaras grigoryevich shevchenkohomo sapiens neanderthalensissir frederick william herschel
...View all with 27 letters...
Phrases (39)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngercommission on the status of womenfederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskyludwig josef johan wittgensteinsergei mikhailovich eisensteindissident irish republican army
...View all with 28 letters...
Phrases (23)
aleksandr nikolayevich scriabindisorganized type schizophreniacapital of the russian federationhydrangea macrophylla hortensisconstitution of the united statespresident william henry harrisonsecond epistle to the corinthiansgeorges joseph christian simenonarrhenius theory of dissociationsecondary sexual characteristic
...View all with 29 letters...
Phrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedouble standard of sexual behaviorjacques anatole francois thibaultaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedentesther hobart mcquigg slack morris
...View all with 30 letters...
Phrases (16)
united states public health servicesecond epistle to the thessaloniansmarie louise elisabeth vigee-lebrunsir john frederick william herschelanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wildefrancoise-athenais de rochechouartcommonwealth of independent statesfibrocystic disease of the pancreas
...View all with 31 letters...
Phrases (11)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatetheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzkiprogressive emphysematous necrosis
...View all with 32 letters...
Phrases (14)
characteristic root of a square matrixepistle of paul the apostle to philemonorganization of the oppressed on earthelizabeth cleghorn stevenson gaskellmusculus sphincter ductus choledochisir winston leonard spenser churchillkonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human services
...View all with 33 letters...
Phrases (14)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human services
...View all with 34 letters...
Phrases (10)
national baseball hall of fame and museumjohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadehereditary motor and sensory neuropathychristopher william bradshaw isherwoodtransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (8)
sisters of the order of saint basil the greatfirst epistle of paul the apostle to timothysecretary of housing and urban developmentkarl friedrich hieronymus von munchhausenepistle of paul the apostle to the ephesiansepistle of paul the apostle to the galatianscongregation of the sisters of saint hedwigsupreme headquarters allied powers europe
