Words Containing: I,S,A,Y,A
(In Any Order)
There are 1,509 words,
2,575 phrases and
0 abbr's with
I,S,A,Y,A in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
airways | 7 | 13 | nounn | |||||
noun • a duct that provides ventilation (as in mines) • a designated route followed by airplanes in flying from one airport to another • the passages through which air enters and leaves the body • a commercial enterprise that provides scheduled flights for passengers | ||||||||
aliyahs | 7 | 13 | nounn | |||||
noun • (Judaism) the honor of being called up to the reading desk in the synagogue to read from the Torah • (Judaism) immigration of Jews to Israel | ||||||||
pitayas | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
pirayas | 7 | 12 | ||||||
Valid word for Scrabble US
| ||||||||
gainsay | 7 | 11 | verbv | |||||
verb • take exception to | ||||||||
naysaid | 7 | 11 | verbv | |||||
verb • To speak negatively of something. • To reply no. | ||||||||
yautias | 7 | 10 | nounn | |||||
noun • tropical American aroid having edible tubers that are cooked and eaten like yams or potatoes | ||||||||
aliyas | 6 | 9 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (54)
analysismalaysiastairwaysanitarydisarrayasphyxiaassyrianmainstaybioassayphysaliasalivarysagacitybayesianstaysailsannyasicalisayasalacitygainsaysairplaysmyalgiasaislewayjanisaryassayingthisawaygymnasiafairwaysdystaxiasatiablytaxiwaysrailwaysmisassaybasilarypyaemiasnasalityaraysing
...View all with 8 letters...
Phrases (3)
sign awayslip awaylay asideWords (89)
basicallyhimalayasparalysismalaysiananalysinghairsprayamarylliscausalityupsadaisyrascalityabyssiniaspatiallyjanissarydysphasiadysplasiaanalyticssannyasincatalysisstairwaysdialysatetrainwaysbioassaysdyscrasiaaislewaysgiveawaysanisogamymainstaysasphyxialasphyxiasadvisablyarythmiassagittarysannyasisgraymailsgymnasial
...View all with 9 letters...
Phrases (8)
in any casedyaus pitahair spraylady's maidsaint's daysix-day wareasy chairwhisk awayWords (142)
mayonnaiseyugoslaviastationaryunsanitaryabyssinianasphyxiateparalysingsalicylateisocyanatehypoplasiainsanitaryinsatiablydysarthriasatyriasismagistracymyastheniapantywaistfantasyingsanguinarysalabilityabrasivelykanamycinsreanalysisdialysatesdialyzatesdysplasiasbioassayedsalutarilydisarrayedsanitarilywayfaringssannyasinsdairymaidsdyscrasiasgalabiyahs
...View all with 10 letters...
Phrases (14)
paris daisytake it easydwarf daisyspirit awaykansas citygenus layiabinary starway stationquai d'orsayspray paint
...View all with 10 letters...
Words (171)
anniversarydrasticallyaristocracycataclysmicfashionablyclassicallyhypospadiasyugoslavianasphyxiatedangioplastyinescapablysartoriallyanalysationrapaciouslyimmunoassayantislaverymasticatoryanaphylaxishyperplasiasagaciouslycausticallysalaciouslyspasticallyelasticallyvagariouslywashabilitysatanicallyphantasyingplasticallybioassayinginseparablydisplayablemisanalysiscastabilitymagistrally
...View all with 11 letters...
Phrases (45)
grass familylaying wasteoryza sativavena cysticadisplay casesan diego baysubway traincassius claysumac familypassion play
...View all with 11 letters...
Words (217)
occasionallypennsylvaniapassionatelysatisfactorystraightawaymetaphysicaltransylvaniaasphyxiationaerodynamicsartisticallyasymmetricalimmeasurablyunmistakablystanislavskysporadicallymajesticallysadisticallyecstaticallysubmaxillarycalamitouslyunassailablyasymptomaticacousticallyasphyxiatingnauseatinglysynaesthesiaavariciouslysemiannuallyadvisabilityclassicalitypansexualitybradycardiasmicroanalystanalyzationsparathyroids
...View all with 12 letters...
Phrases (70)
visual acuityscantily cladshaking palsysquirrel awayphantasy lifechristmas dayascension daycost analysissalivary ductall saints' day
...View all with 12 letters...
Words (245)
statisticallyfantasticallysubstantiallyrealisticallystrategicallysarcasticallypainstakinglyaestheticallysensationallydisparaginglypennsylvanianmagisteriallyfascinatinglyrhapsodicallynostalgicallycryptanalysisspasmodicallysyntacticallymagnanimouslygeostationarysituationallytantalisinglyunfashionablyastrophysicaltransitionaryinsatiabilityimpassabilityhyaluronidasebombasticallymeasurabilityspreadabilityholidaymakersautocatalysisgymnasticallyimagistically
...View all with 13 letters...
Phrases (106)
aleatory musicel iskandriyahin a similar wayadvisory boardspiny anteatercooley's anemiaacrylate resincanary islandsjapanese deitysalivary gland
...View all with 13 letters...
Words (189)
psychoanalysissystematicallysustainabilityunsatisfactorypsychoanalyticsatisfactorilyembarrassinglymetaphysicallyscholasticallyastronomicallyidealisticallyaltruisticallydiagnosticallyastrologicallyasymmetricallycycloparaffinspleasurabilityaxisymmetricalmoralisticallymetaphysicianscarbonylationsstochasticallyparadisiacallyassimilabilityallostericallysalvageabilityexasperatinglyantisepticallypleonasticallypacifisticallyhumanisticallyaphoristicallynaphthylaminesstagflationarycytostatically
...View all with 14 letters...
Phrases (156)
order mysidaceamyrrhis odoratasabbatical yearadmiralty brassmaxillary sinusbusman's holidaycarya laciniosacooley's anaemiadrainage systemabstract entity
...View all with 14 letters...
Words (176)
instantaneouslyanaesthesiologycrystallizationcompassionatelylackadaisicallyinspirationallygastronomicallysympatheticallydispassionatelyritualisticallypsychiatricallysystematizationagranulocytosissymptomaticallyphysiographicalpsychoanalyzingcyanocobalaminspolysaccharidessycophanticallyelectroanalysishypersalivationunassailabilityankylostomiasesankylostomiasispostapocalyptictrypanosomiasisintravascularlyunrealisticallyancylostomiasesancylostomiasisdisinflationaryobservationallypolyacrylamidesunsubstantiallyanalyzabilities
...View all with 15 letters...
Phrases (195)
syringa vulgarisby fits and startsalimentary pasteasamiya languagedialysis machinejohn quincy adamsadmiralty islandfamily astacidaeradial asymmetrylouisa may alcott
...View all with 15 letters...
Words (81)
enthusiasticallycatastrophicallypsychoanalyticaljournalisticallycircumstantiallymonosyllabicallythermostaticallysurrealisticallyparapsychologistconversationallyhypersalivationsantistrophicallyparaphrasticallyadministrativelyparapsychologiespolysynapticallyparasympatheticsmalayo-polynesianmonosynapticallyarchiepiscopallyhypostatizationsiconoclasticallycrystallizationsunsubstantialitystenographicallycrystallographicinsubstantialityflabbergastinglypostsynapticallyecclesiasticallycyanocobalaminesasymptomaticallycyanoethylationsperiphrasticallyrelativistically
...View all with 16 letters...
Phrases (196)
in a beastly mannercardiac glycosidechemical analysisamerican sycamorepodocarpus familyfamily locustidaecarya illinoensiscarya illinoinsissubfamily bovinaeofficial emissary
...View all with 16 letters...
Words (40)
straightforwardlymaterialisticallycardiorespiratoryelectrostaticallyprobabilisticallykaleidoscopicallyradioimmunoassaysradioisotopicallyparapsychologistsparasitologicallyrationalisticallypaternalisticallyunderstandabilityidiosyncraticallycrystallographiesuntranslatabilitytranscriptionallylymphadenopathiestransdisciplinaryrecrystallizationnationalisticallytransplantabilitytransthoracicallyacetylsalicylatessamoyedic-speakingglycosaminoglycanimperialisticallydisadvantageouslyunsympatheticallyimprovisationallymetapsychologicalcarboxypeptidasesanachronisticallyrhynchocephaliansparapsychological
...View all with 17 letters...
Phrases (219)
salvia leucophyllabalaena mysticetusinterstate highwaypearly everlastingfamily dasypodidaelycopus americanussubphylum craniatamalaysian languagecylinder separatorcaesarian delivery
...View all with 17 letters...
Words (30)
characteristicallypsychopathologicalhypoparathyroidismpathophysiologicallaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographiestransformationallypteridospermaphytarecrystallizationsmucopolysaccharideglycosaminoglycansoscillographicallyspectrographicallyaerothermodynamicsrepresentationallypropagandisticallypsychoanalyticallypsychobiographicalphysiopathologicalhyperalimentationssemiquantitativelytachistoscopicallyunenthusiasticallyclaustrophobicallyhypernationalisticsomnambulisticallyhyperpolarizationshyperrationalitiesPhrases (248)
bombycilla garrulusadministrative bodydivision anthophytafamily physeteridaelachrymal secretionnavigational systemfamily asparagaceaeantipsychotic agentfamily desmidiaceaesquirreltail barley
...View all with 18 letters...
Words (20)
hyperparathyroidismextralinguisticallyparathyroidectomieshypoparathyroidismsnonrelativisticallymucopolysaccharideslipopolysaccharidesconceptualisticallyindividualisticallyphenomenalisticallyhysterosalpingogramhistopathologicallyhistoriographicallyparasympathomimeticpsychopharmacologicsymptomatologicallydiethylcarbamazinestetramethyldiarsineschizosaccharomycespolychromatophiliasPhrases (235)
acetylsalicylic acidscandinavian countryfamily cynoglossidaehydrastis canadensisfamily lepisosteidaezairese monetary unitfamily dasyproctidaecapital of kyrgyzstanavogadro's hypothesiscalycanthus floridus
...View all with 19 letters...
Words (21)
uncharacteristicallyoverenthusiasticallyradioimmunoassayablecrystallographicallylymphogranulomatosismagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseneuropsychiatricallymagnetohydrodynamicsultramicroscopicallyencephalomyocarditispsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyexistentialisticallyhyperparathyroidismsPhrases (227)
william stanley jevonswyethia amplexicaulisorder mycelia sterilialebanese monetary unitorder myxobacterialesdivision tracheophytabalance sheet analysisbyelorussian languagedianthus caryophyllusuniversity of nebraska
...View all with 20 letters...
Words (6)
psychopharmacologicalmucopolysaccharidosisacetylcholinesterasespsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (163)
nikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumsri lankan monetary uniteucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaginglymostoma cirratumparty to the transaction
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (143)
haliaeetus leucorhyphusaleksandr i. solzhenitsynsubfamily bassariscidaerhythm and blues musiciansurinamese monetary unitfamily branchiostomidaesphyrapicus varius ruberindonesian monetary unitedna saint vincent millayamygdalus communis amara
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (116)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentaliskyrgyzstani monetary unitcanyonlands national parkbangladeshi monetary unitsouth korean monetary unittajikistani monetary unit
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (84)
louis seymour bazett leakeyargyroxiphium sandwicensemary wollstonecraft godwinprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisalexandre emile jean yersinapocynum androsaemifoliumtechnology administrationsir charles leonard woolley
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (68)
myroxylon balsamum pereiraediamond wedding anniversaryfrancis scott key fitzgeraldsymphoricarpos orbiculatusbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddingtonandrei arsenevich tarkovskywestern samoan monetary unit
...View all with 25 letters...
Phrases (55)
brassica oleracea gongylodeshunting and gathering societysecretary of veterans affairssubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandsubdivision basidiomycotinanewton's theory of gravitationsubdivision mastigomycotina
...View all with 26 letters...
Phrases (42)
business environment analysisaleksandr sergeyevich pushkinnuclear regulatory commissiondeoxyadenosine monophosphatetricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensistaras grigoryevich shevchenkostationary stochastic processhyacinthus orientalis albulus
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (28)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguesmall computer system interfacecygnus columbianus columbianusimperial japanese morning glorypalestinian national authority
...View all with 28 letters...
Phrases (22)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrison
...View all with 29 letters...
Phrases (22)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedepository financial institutionbalance of international paymentssevere acute respiratory syndromecalymmatobacterium granulomatiscalifornia personality inventorynontricyclic antidepressant drug
...View all with 30 letters...
Phrases (13)
great smoky mountains national parkdigital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activityvladimir vladimirovich mayakovski
...View all with 31 letters...
Phrases (17)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (12)
autonomous sensory meridian responsepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitis
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (8)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicehereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (13)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausen
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay