Words Containing: I,R,Y
(In Any Order)
There are 11,799 words,
7,087 phrases and
3 abbr's with
I,R,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
frizzly | 7 | 31 | adjectiveadj | |||||
adjective satellite • (of hair) in small tight curls | ||||||||
frizzy | 6 | 30 | adjectiveadj | |||||
adjective satellite • (of hair) in small tight curls | ||||||||
grizzly | 7 | 29 | noun, adjectiven, adj | |||||
noun • powerful brownish-yellow bear of the uplands of western North America adjective satellite • showing characteristics of age, especially having grey or white hair | ||||||||
drizzly | 7 | 29 | adverb, adjectiveadv, adj | |||||
adjective satellite • wet with light rain | ||||||||
quirky | 6 | 22 | adjectiveadj | |||||
adjective satellite • (informal) strikingly unconventional | ||||||||
quivery | 7 | 22 | adjectiveadj | |||||
adjective • Quivering; aquiver | ||||||||
crazily | 7 | 21 | adverbadv | |||||
adverb • in an insane manner | ||||||||
squirmy | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
pyrexic | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (480)
historyrealityvictorylibrarythirstycharityprivacylibertyprimarygravityrailwaypyramidvarietyrapidlyinquirybrieflyfirstlyburyingclarifytrinityclaritygrizzlyhillarysyringecrucifyrightlyvarsityrelyingchristybriberyenquiryprodigyimageryfireflymerrily
...View all with 7 letters...
Phrases (18)
stir frypay dirtguy wirewild ryedry kilndry milkdry pintdry unith. pylorihair dye
...View all with 7 letters...
Words (871)
birthdaysecuritymilitarycarryingordinarydirectlyfriendlydeliveryindustryentirelymarryingterriblyworryingministryeternityprioritymajoritystrictlysolitaryslipperypartyingmoralityliteraryminoritydrivewayinfantrybrittanyhorriblyvineyardyearningserenitysororitycylinderseminaryhysteria
...View all with 8 letters...
Phrases (44)
by rightsminor keydrying upiron ladyrainy dayin theoryarmy unitbody hairgregory iholy writ
...View all with 8 letters...
Words (1249)
boyfriendseriouslycertainlyauthorityliterallyterritorypreciselydiscoverycelebritychemistrycuriosityvirginitysincerelyimaginaryintegrityvirtuallycertaintymysteriesmachineryartilleryyggdrasilinventoryprivatelyhypocriteinfirmarysincerityformalitydiversitybrutalitymaternityhairstylefertilityprimarilybiographyhypocrisy
...View all with 9 letters...
Phrases (107)
direct dyeloya jirgaman fridaylike crazyground ivygrey friarright awaygin rickeyhair dryeralloy iron
...View all with 9 letters...
Words (1558)
everythinguniversitymysteriousincrediblyoriginallyconspiracypreviouslyterrifyinghystericalbabysitterrelativelydictionaryprosperitygenerositycreativityfraternitysolidaritymissionarytypewriterpopularitypresidencytragicallyhorrifyingironicallyhereditaryinsecuritypsychiatryunderlyingdiscreetlyrelativityunbirthdayrightfullyinternallysimilarityveterinary
...View all with 10 letters...
Phrases (188)
bombyx moriepoxy resinprivate eyeenergy unitmaxim gorkyrift valleyyemeni rialparis daisyrailway carcanary bird
...View all with 10 letters...
Words (1735)
opportunityelectricityanniversarypersonalitypracticallydifferentlynecessarilyimportantlycountrysidepsychiatrictemporarilypreliminarycredibilityimmortalityvoluntarilyprobabilityaccordinglyuncertaintydaydreamingsovereigntymomentarilycalligraphybeneficiarysuperiorityrespiratoryreactionaryspirituallytranquilitybrilliantlysymmetricalinvoluntarymercilesslydrasticallyhypothermiamonstrosity
...View all with 11 letters...
Phrases (297)
grass familyin a broad waysilver berryelinor wyliebulb syringebryonia albaadmiral byrdspiny puffersensory hairsingle entry
...View all with 11 letters...
Words (1637)
particularlypsychiatristdeliberatelychristianityincreasinglysurprisinglyevolutionarydramaticallydisciplinarypenitentiarysatisfactorymysteriouslyhypocriticalspiritualitystraightawayconsiderablymiraculouslysynchronizedhistoricallyaggressivelyproductivitybloodthirstyridiculouslyromanticallystorytellingartificiallytranquillityhystericallyhorizontallyparamilitarytransylvaniaperiodicallyintermediarybiochemistryinflammatory
...View all with 12 letters...
Phrases (396)
woody guthriemolly pitcherstaying powerwilliam wyleradmiral deweyread-only filesquirrel awayadmiralty lawmyrtle familygenus syringa
...View all with 12 letters...
Words (1377)
extraordinaryrevolutionaryapproximatelyunnecessarilytheoreticallytraditionallyvulnerabilityautobiographycontradictoryinterestinglyappropriatelycomplimentaryparliamentaryinadvertentlyradioactivityprogressivelyhieroglyphicsrealisticallyprecautionarystrategicallypredominantlyhypochondriacimprobabilitycategoricallyphysiotherapyinvoluntarilyparadoxicallyfrighteninglycomparativelyirretrievablysarcasticallyalternativelynitroglycerineverlastinglyhyperhidrosis
...View all with 13 letters...
Phrases (485)
harvey cushingaleatory musicel iskandriyahfamily laridaevaginal arterydirect antonymauditory sensegilbert murraybitter hickoryin a similar way
...View all with 13 letters...
Words (1060)
responsibilityprofessionallycinematographymetaphoricallyelectronicallydemocraticallyoverwhelminglyrespectabilitygeographicallyhypersensitiveinterplanetarycardiomyopathyastrophysicistunsatisfactorythermodynamicsterritorialityhyperventilateproportionallynitroglycerineexcruciatinglyintermittentlyconservativelydiscriminatorypredictabilityclitoridectomypsychoneuroticsatisfactorilyembarrassinglyexperimentallynephrotoxicityreproductivelydiscourteouslynarcosynthesismicrochemistryconstructively
...View all with 14 letters...
Phrases (547)
pearl mae baileythoracic cavityorder mysidaceafamily ardeidaemyrrhis odoratapituitary dwarfpituitary glandtrionyx muticusveliky novgorodyellowish brown
...View all with 14 letters...
Words (769)
extraordinarilyinternationallypsychotherapistsynchronizationenvironmentallyinappropriatelydisrespectfullyphysiotherapistheterosexualitychronologicallysynergisticallycrystallizationoversimplifyingsurreptitiouslyparentheticallyplenipotentiarymicroscopicallyaerodynamicallyproportionatelymaneuverabilitycardiopulmonarytherapeuticallysynchronisationinstrumentalityinvulnerabilitycontroversiallyneurophysiologycytomegalovirusuncomplimentarystereochemistryrecrystallizingpostoperativelyintrospectivelyunparliamentaryproportionality
...View all with 15 letters...
Phrases (641)
syringa vulgarisauditory ossicleby fits and startsbenefit of clergyalimentary pastemount nyiragongoadvisory servicefamily arecaceaemail-order buyingprivate property
...View all with 15 letters...
Words (321)
indiscriminatelyirresponsibilityhemorrhoidectomyincomprehensiblycatastrophicallytriphenylmethanehyperintelligentunpredictabilityhyperventilationimperceptibilityuncompromisinglyjournalisticallynonrevolutionarycircumstantiallypharmaceuticallyerythroblastosisthermostaticallysurrealisticallyincontrovertiblythrombocytopeniaelectrochemistryhypersensitivityphotographicallyunprofessionallyparapsychologistconversationallyincorruptibilityneuropsychiatricpolydispersitiesdiscriminatorilyhypersalivationsparadigmaticallypornographicallycolorimetricallyexterritoriality
...View all with 16 letters...
Phrases (626)
hypodermic needletympanic membranein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaechristian huygensfamily cyprinidaecapital of hungarywilliam wycherley
...View all with 16 letters...
Words (197)
straightforwardlycounterinsurgencybacteriologicallysuperconductivityanthropologicallyparathyroidectomymaterialisticallycardiorespiratoryneurophysiologistelectrostaticallythermodynamicallyphilanthropicallypsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryantirevolutionaryhyperreactivitiesself-contradictoryradiobiologicallyisoelectronicallyphysiotherapeuticcercidiphyllaceaethermoperiodicityradioimmunoassaysradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionallymonochromaticallyrationalisticallythrombocytopenias
...View all with 17 letters...
Phrases (618)
mary leontyne pricedivision bryophytaczech monetary unitproteolytic enzymecuban monetary unitinterstate highwaypearly everlastinglycopus americanussubphylum craniataotto fritz meyerhof
...View all with 17 letters...
Words (103)
characteristicallydisproportionatelyhypercoagulabilityhyperaldosteronisminterchangeabilityneuropsychologicalhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationspectroheliographypolyribonucleotidenoncomprehensivelypsychotherapeuticssphygmomanometrieshypoparathyroidismanthropocentricitycylindrical-stemmedlaryngopharyngitislipopolysaccharidetriphosphopyridinelymphangiographieshyperbilirubinemiastereospecificallytransformationallycalymmatobacteriumstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylurearecrystallizationsdiethylstilbestrolcounterintuitivelymucopolysaccharidehypercholesteremia
...View all with 18 letters...
Phrases (627)
bombycilla cedrorunworldly possessionsbombycilla garrulusrevolutionary groupadministrative bodyfamily physeteridaedame sybil thorndikeeriobotrya japonicalachrymal secretionfreudian psychology
...View all with 18 letters...
Words (82)
hyperparathyroidismhydrochlorothiazidecinematographicallypolyesterificationshypersensitizationsextralinguisticallypolyribonucleotidesotorhinolaryngologyextraterritorialityhypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismscrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidescytodifferentiationimmunocytochemistrydiethylstilbesteroldiethylstilboestrolbacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationmercury-contaminatedinterconvertibilitychromoblastomycosisinterdepartmentallyelectromagneticallycontradistinctively
...View all with 19 letters...
Phrases (550)
water-plantain familyfamily cyclopteridaescandinavian countryitalian monetary unithydrastis canadensislatvian monetary unitmillimeter of mercuryalpine type of glaciergiles lytton stracheyphytolacca americana
...View all with 19 letters...
Words (48)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolhypersensitivenessespolyphiloprogenitiveradioimmunoassayableparathyroidectomizedlipochondrodystrophycrystallographicallyhyperadrenocorticismcytodifferentiationslymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicsiodochlorhydroxyquinultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryroentgenographicallyencephalomyocarditischemotherapeutically
...View all with 20 letters...
Phrases (457)
honduran monetary unityellow-shafted flickerorder mycelia steriliamalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridaeoryctolagus cuniculusmarchantia polymorphadivision tracheophyta
...View all with 20 letters...
Words (19)
psychopharmacologicalotorhinolaryngologisthypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesmucopolysaccharidosisacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationsintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (346)
icelandic monetary unitelectrolytic condensernikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidhungarian monetary unit
...View all with 21 letters...
Words (9)
spectrophotometricallyintercomprehensibilityotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninemicrospectrophotometryPhrases (280)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (207)
family threskiornithidaeposterior pituitary glandmeperidine hydrochlorideyellowstone national parkkazakhstani monetary unitthryothorus ludovicianusparis-sorbonne universityinterlocutory injunctionkyrgyzstani monetary unitcanyonlands national park
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallymicroelectrophoreticallyschizosaccharomycetaceaePhrases (145)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinprivately held corporationzollinger-ellison syndromeprimary sex characteristicsir terence mervyn rattigan
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (106)
myroxylon balsamum pereiraeigor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencymodest petrovich mussorgskypropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friends
...View all with 25 letters...
Phrases (84)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virussecretary of veterans affairssubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrand
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (67)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (54)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating system
...View all with 28 letters...
Phrases (32)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndrome
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (29)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (20)
great smoky mountains national parkfreedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agency
...View all with 31 letters...
Phrases (24)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeley
...View all with 32 letters...
Phrases (16)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapy
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricuseinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (8)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (13)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausen
...View all with 37 letters...