Words Containing: I,P,E,L,Y
(In Any Order)
There are 2,606 words,
2,130 phrases and
0 abbr's with
I,P,E,L,Y in.
Best Scoring Words With: I,P,E,L,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
peppily | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
perkily | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a perky manner | ||||||||
peskily | 7 | 16 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
emptily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
primely | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
limpsey | 7 | 14 | ||||||
Valid word for Scrabble US
| ||||||||
epiboly | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
yelping | 7 | 13 | verb, noun, adjectivev, n, adj | |||||
noun • a sharp high-pitched cry (especially by a dog) | ||||||||
tepidly | 7 | 13 | adverb, adjectiveadv, adj | |||||
adverb • in an unenthusiastically lukewarm manner | ||||||||
clypei | 6 | 13 | nounn | |||||
noun • The shield-shaped front part of an insect's head or a spider's cephalothorax. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (65)
slipperypolitelyepilepsyplaytimepriestlyprincelypleurisyspeedilyprettilysleepilydiphenyllinotypelipocyteepistylereplyingeuploidypyrexiallyophilesupinelycreepilybiphenylepicallypyrolizepenalitypaisleysimpurelyepicalyxpolypideepicyclephenylicalpinelyoxyphilephyleticpolyenicpyelitis
...View all with 8 letters...
Phrases (3)
pine lilyptolemy iclay pipeWords (137)
preciselyspeciallyspecialtyprivatelydisplayedpatientlypolynesiapassivelyinterplaypointedlyparleyingpainterlypolygenicpensivelypiteouslypriestleypuerilityexemplifyhyperlinkpuppylikepeevishlysylphlikeweepinglylipocyteslipolysespolymericmicropylesyruplikeredisplaymisemployplenarilypuerilelylyophileddisplayerbiphenyls
...View all with 9 letters...
Phrases (11)
emily postwiley postpineal eyeparty lineptolemy iilyric poempea familypublic eyepeace lilysimple eye
...View all with 9 letters...
Words (248)
especiallypreviouslypositivelyspecialitycomplexityexplicitlysplendidlypainlesslyimproperlyimpeccablysheepishlypolynesianepicondyleperilouslyhieroglyphpoeticallypeculiarlyintrepidlyunpriestlypitilesslyimpudentlyhyperbolicpleasinglyreapplyingpolytheisminexpertlyclypeiformlyophilizepolytheistepiphysealepiphysialcyclopediaperplexityoppositelypreciously
...View all with 10 letters...
Phrases (24)
field pansypineal bodypaddy fieldpuebla citytype familyfield poppytriple playpine familyruby spinelhemp family
...View all with 10 letters...
Words (346)
personalitytemporarilypreliminarypotentiallypsychedelicresponsiblypolytechnicimpatientlyimpulsivelydeceptivelypredictablysphericallyexpedientlyexpensivelyexplosivelypeculiarityirreparablyprominentlypsychedeliageophysicalhypokalemiaprimitivelyrepulsivelyhypokalemicempiricallypointlesslyinescapablyimperfectlyimpetuouslyhypovolemicskepticallyroleplayingappreciablyplentifullyimpermeably
...View all with 11 letters...
Phrases (43)
playing areaspecial jurypiano playerpolicy makerdisplay caselamp chimneyidler pulleyship's galleypearl hominystay in place
...View all with 11 letters...
Words (405)
specificallypennsylvaniapassionatelyencyclopediahypotheticalmetaphysicalperiodicallypatheticallyinexplicablyrespectivelyperipherallyhieroglyphicpersistentlytheophyllinehypochloriteemphaticallycompulsivelyegyptologistprecariouslyproficientlycompellinglypolicyholderphylogeneticpejorativelyhypoglycemicimpressivelyhyperkalemiaproverbiallyepidemiologyphoneticallypotentialitydepressinglydespairinglyencyclopedichypoglycemia
...View all with 12 letters...
Phrases (75)
molly pitcherlickety splitathletic typephantasy lifepolicy changetennis playerpetit larcenyperiod of playtenpenny naildisplay panel
...View all with 12 letters...
Words (431)
approximatelyexceptionallyindependentlyappropriatelycomplimentaryparliamentaryprogressivelyhieroglyphicspredominantlyexponentiallycomparativelystereotypicalirresponsiblysuperficiallyimperceptiblyencyclopaediahypoglycaemicpreliminarilyneurosyphilisdependabilitycompetitivelyprovocativelypredominatelyhypercalcemiaincompetentlypicturesquelyhyperglycemicinexpensivelypennsylvanianexpeditiouslyacceptabilitysuperlativelyinexpressiblyimpermissiblyperspectively
...View all with 13 letters...
Phrases (85)
family picidaefamily poaceaeplum-yew familyheavy particleamyloid plaquepays de la loirelivery companylatency periodprinted symbolleontyne price
...View all with 13 letters...
Words (355)
responsibilityprofessionallyhypotheticallymetaphoricallyrespectabilitygeographicallyalphabeticallyinterplanetaryhyperventilatepredictabilitysusceptibilityexperimentallymetaphysicallytelepathicallyreproductivelyappreciativelysuperficialitypolymerizationpyelonephritisprovidentiallyorthopedicallyarchetypicallyunsuspectinglytelephonicallypreferentiallypraiseworthilyoverpoweringlyimpermeabilityhyperbolicallybrachycephalicempatheticallyimpregnabilitysuperciliouslycomprehensiblydepolymerizing
...View all with 14 letters...
Phrases (130)
family apiaceaepearl mae baileycapital of kenyavisual propertypolymeric amidechinese parsleydizzy gillespiemost especiallyfamily vespidaelife expectancy
...View all with 14 letters...
Words (253)
inappropriatelydisrespectfullyoversimplifyingsurreptitiouslyparentheticallyplenipotentiaryproportionatelytherapeuticallyneurophysiologycompassionatelyuncomplimentarymethylphenidatepostoperativelyintrospectivelyunparliamentaryuninterruptedlyunacceptabilitysympatheticallydispassionatelycorrespondinglyretrospectivelydemographicallyeuphemisticallypessimisticallycomprehensivelyperpendicularlyimperishabilitycontemptibilitysidesplittinglyreproducibilitynonspecificallycontemplativelyemployabilitiesteletypewriterscomplementarity
...View all with 15 letters...
Phrases (188)
alimentary pastefamily leporidaepsychotic beliefstonecrop familyfamily lophiidaepipeline companybroomrape familylymphatic vesselinsurance policybrittany spaniel
...View all with 15 letters...
Words (133)
irresponsibilityincomprehensiblytriphenylmethanehyperintelligentunpredictabilityhyperventilationphylogeneticallyimperceptibilitypharmaceuticallyunapologeticallyunprofessionallypolydispersitieshypersalivationsparamagneticallynoncompetitivelyhypersexualitiespolyphyleticallythermoplasticityhyperstimulatinghyperstimulationimperfectibilityantiunemploymentparapsychologieshypersusceptiblehyperventilatingmalayo-polynesianhemoglobinopathyarchiepiscopallyleukodystrophiesperpendicularitymorphometricallyindispensabilitylyginopteridalesstenographicallyflexographically
...View all with 16 letters...
Phrases (166)
hypodermic needlestrictly speakingfamily cyperaceaefamily cyprinidaecalystegia sepiumcapital of new yorkpharyngeal tonsilfamily punicaceaefamily pythonidaegrand mal epilepsy
...View all with 16 letters...
Words (92)
neurophysiologistinterdisciplinarycercidiphyllaceaekaleidoscopicallyspondylolisthesishyperstimulationsspectroscopicallyhyperventilationsnonprofessionallyhypnotizabilitiespaternalisticallypathophysiologiesmorphogeneticallylexicographicallycryptocrystallineencephalomyelitiscrystallographiespostrevolutionarymicropaleontologydisrespectabilitylymphadenopathieshyperalimentationcyclophosphamidesoceanographicallythiodiphenylamineonomatopoeticallyphenylethylaminesnephelometricallyzoogeographicallyptilonorhynchidaeimperialisticallytriphenylmethaneshyperintelligencejurisprudentiallyneurophysiologies
...View all with 17 letters...
Phrases (227)
mary leontyne pricesalvia leucophyllaproteolytic enzymehypoglycemic agentpearly everlastingfamily dasypodidaelycopus americanuscapital of kentuckycylinder separatorfamily didelphidae
...View all with 17 letters...
Words (41)
disproportionatelyhypercoagulabilityhyperaldosteronismneuropsychologicalpolyesterificationspectroheliographypolyribonucleotidenoncomprehensivelylipopolysaccharidelymphangiographieshyperbilirubinemiastereospecificallymucopolysaccharidehypercholesteremiamyeloproliferativephenomenologicallygranulocytopoiesesspectrographicallygranulocytopoiesispolypropenonitrileneurophysiologistsrepresentationallyelectromyographiesneuropsychologistsmetallographicallyelectrophysiologicmethylprednisolonedephosphorylationsphotosyntheticallyoveroptimisticallyhyperalimentationssemiprofessionallyphytohemagglutininpsychophysiologiesneurophysiological
...View all with 18 letters...
Phrases (202)
worldly possessionsrevolutionary groupfamily physeteridaefreudian psychologypodilymbus podicepsread-only memory chipkilocycle per secondsuperiority complexfamily asparagaceaefamily polygalaceae
...View all with 18 letters...
Words (37)
cinematographicallypolyesterificationspolyribonucleotideshypersusceptibilityhypolipoproteinemiaparthenogeneticallymucopolysaccharideslipopolysaccharidesconceptualisticallybacteriochlorophyllphenomenalisticallyphenylthiocarbamidephosphatidylcholineinterdepartmentallyhysterosalpingogramimpressionisticallyelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistanthropocentricallyelectroretinographyincomprehensibilityencephalomyelitidesphenylpropanolamineoverproportionatelyphytogeographicallyphytohemagglutininspsychotomimeticallyhyperemotionalitiesdimethyltryptamineshyperexcitabilitiescytophotometricallyhyperirritabilitiespaleogeographically
...View all with 19 letters...
Phrases (199)
building supply housewater-plantain familyfamily cyclopteridaealpine type of glacierphytolacca americanafamily lepisosteidaefamily dasyproctidaefamily tropaeolaceaefamily polypodiaceaesalicylate poisoning
...View all with 19 letters...
Words (20)
hypercholesterolemiapolyphiloprogenitivebacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesoophorosalpingectomyphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaelectrophysiologicalelectrophysiologistsroentgenographicallyencephalomyocarditischemotherapeuticallypsychopharmacologiesmicrophotometricallyhypercholesterolemichypercoagulabilitiesplethysmographicallyPhrases (158)
wyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaefamily pseudococcidaefriendly relationshipamyloid protein plaquepolitically incorrectglycerol tripalmitatesupplementary benefitphylogenetic relation
...View all with 20 letters...
Words (7)
hypogammaglobulinemiahypersusceptibilitiesstereomicroscopicallyelectromyographicallypolyvinyl-formaldehydehypercholesterolemiaspsychotherapeuticallyPhrases (149)
eucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaptolemy ii philadelphusspectroscopic analysisprocaine hydrochloridefamily myrmecophagidaespeech intelligibilityphylum platyhelminthesprosopium cylindraceum
...View all with 21 letters...
Words (5)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyencephalomyocarditisesdihydroxyphenylalaninePhrases (126)
lycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathysodium tripolyphosphatehigh-density lipoproteinathyrium thelypteroidesmale reproductive systematmospheric electricity
...View all with 22 letters...
Words (1)
hypobetalipoproteinemiaPhrases (86)
posterior pituitary glandmeperidine hydrochlorideyellowstone national parkdorothy rothschild parkersciadopitys verticillatatricyclic antidepressanteastern malayo-polynesianamerican federalist partywestern malayo-polynesianminister plenipotentiary
...View all with 23 letters...
Words (4)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (53)
privately held corporationapocynum androsaemifoliumexistentialist philosophyfederal republic of germanychrysosplenium americanumhaematoxylum campechianumanal retentive personalityoxidative phosphorylationelectroconvulsive therapypaul johann ludwig von heyse
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (34)
myroxylon balsamum pereiraepropoxyphene hydrochloridepolystichum acrostichoidescaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinmichelson-morley experimentlepidocybium flavobrunneumaleksey maksimovich peshkovspecial theory of relativity
...View all with 25 letters...
Phrases (33)
employee stock ownership planbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosusscardinius erythrophthalmussuperorder labyrinthodontianontricyclic antidepressantintermediate temporal artery
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (29)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanatricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteintopical prostaglandin eyedrop
...View all with 27 letters...
Phrases (20)
revolutionary people's struggleephippiorhynchus senegalensistriphosphopyridine nucleotidecardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armyrevolutionary proletarian armysmall computer system interfacesingle nucleotide polymorphismimperial japanese morning glory
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (16)
antisocial personality disorderinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibriumanonymous file transfer protocolpressure-feed lubricating system
...View all with 29 letters...
Phrases (20)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentspolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalifornia personality inventory
...View all with 30 letters...
Phrases (9)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economysubacute inclusion body encephalitisphysiological jaundice of the newborn