Words Containing: I,N,Y,E,S
(In Any Order)
There are 3,332 words,
2,950 phrases and
0 abbr's with
I,N,Y,E,S in.
Best Scoring Words With: I,N,Y,E,S
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jitneys | 7 | 17 | nounn | |||||
noun • a vehicle carrying many passengers; used for public transport | ||||||||
pinkeys | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
kidneys | 7 | 15 | nounn | |||||
noun • either of two bean-shaped excretory organs that filter wastes (especially urea) from the blood and excrete them and water in urine | ||||||||
dinkeys | 7 | 15 | nounn | |||||
noun • a small locomotive | ||||||||
winceys | 7 | 15 | ||||||
noun • a plain or twilled fabric of wool and cotton used especially for warm shirts or skirts and pajamas | ||||||||
skyline | 7 | 14 | nounn | |||||
noun • the outline of objects seen against the sky • the line at which the sky and Earth appear to meet | ||||||||
densify | 7 | 14 | verbv | |||||
verb • To make dense. • To become dense. | ||||||||
kyanise | 7 | 14 | ||||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
swinney | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
witneys | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (63)
destinysyringesnidelydensityskylineelysianswinneyspinneysyenitetensitycysteindensifykidneysisogenydingeyskyanisedinkeyswitneysjitneyswinceysyeelinsbylinessynesisanywisepigsneybyrniesespyinglysinescystinemyelinsdyeingslinseysyessingshinneypinkeys
...View all with 7 letters...
Phrases (1)
in styleWords (129)
silentlyserenityseminaryinsanelysyringessensiblysenilitysteinwayunwiselysnippetymoseyingsneakilycytosinetyrosinebayesianuneasilysnivellyhyoscinesaliencycyanidessyringedsynectichyalinesyeastingsynergiaresayingbylinersskylinessupinelyresinifysyndeticessayingsyenitessyeniticcysteine
...View all with 8 letters...
Phrases (4)
by designinbus keyby inchesmind's eyeWords (256)
testimonysincerelynecessityintensitysincerityseeminglysyntheticsyndicateintenselyimmenselyresidencyobscenitysenioritysynthesiseasygoingsurveyingintensifyimmensitydentistryhygienistpolynesiastorylineheinouslykeynesianhypnotisesolemnitylyonnaisehesitancydysgenicseyestraininverselypersonifysteadyingconciselysisyphean
...View all with 9 letters...
Phrases (12)
fine sprayeasy goingin any casemike tysondeadly sinpenis envythe skinnyskinny tiespin dryersticky end
...View all with 9 letters...
Words (386)
universitygenerositydisneylandmayonnaiseeyewitnesspresidencyinsecuritytestifyingsensualitystationerymistakenlydishonestyhieronymusinsurgencystrychninesyndicatedsplendidlydispensarypainlesslyostensiblyinsolvencysynthesizepropensitypolynesianhypnotisedmindlesslyspecifyingstringencyisocyanateunpriestlyfiendishlysynthesisecryogenicshypersonicresiliency
...View all with 10 letters...
Phrases (34)
epoxy resinfield pansyunix systemnorse deitysidney webbwalt disneyin a pig's eyehoney crisptin pyritesyemeni fils
...View all with 10 letters...
Words (484)
anniversarypersonalitynecessarilyessentiallycountrysidesensitivitysovereigntyconsistencyspontaneitysensibilityuniversallysynchronizesynthesizerincessantlydiscrepancyextensivelyresponsiblycrystallineserendipitysedimentaryscientologyintensivelysynesthesiasynthesizeddefensivelyoffensivelypersnicketyexpensivelysufficiencyobstinatelydishonestlymonkeyshinedeservinglysensitivelyhypotensive
...View all with 11 letters...
Phrases (63)
genus myxinelaying wastebulb syringespiny puffersensory hairsingle entryclosely knitvena cysticagenus zoysiacypress vine
...View all with 11 letters...
Words (510)
increasinglypennsylvaniapassionatelysufficientlyconsiderablygynecologistconsistentlysynchronizedstorytellingconstituencybiosynthesisaerodynamicshypertensionconclusivelypresbyterianpersistentlyrefreshinglyhypertensivepyrotechnicssynchroniseddiversionaryforensicallystaggeringlystereotypingintensifyingincestuouslyconvulsivelyuniversalitydepressinglydespairinglyresoundinglysequentiallydiversifyingexclusionarystreptomycin
...View all with 12 letters...
Phrases (106)
staying powergenus glycinechinese deityphantasy lifegenus syringaascension dayacrylic resinyenisey riverstring theorygenus cydonia
...View all with 12 letters...
Words (467)
unnecessarilyinstinctivelyinterestinglygynaecologisteverlastinglyconsecutivelyirresponsiblydiscretionaryunsympatheticinconsistencyintravenouslydistressinglysensationallyneurosyphilisinsufficiencyinsensitivitydimensionallysentimentallyinsensitivelyunobtrusivelyexistentiallydistinctivelyceremoniouslyincredulouslysyntheticallyinexpensivelymeaninglesslyindescribablyconfessionarypennsylvanianquestioninglyphysostigminehypothesisingconcessionaryinexpressibly
...View all with 13 letters...
Phrases (175)
harvey cushingel iskandriyahauditory sensebrandy snifterspiny anteatermyrsine familydrimys wintericooley's anemiaacrylate resinjapanese deity
...View all with 13 letters...
Words (410)
responsibilitysimultaneouslyprofessionallyscientificallysentimentalityhypersensitiveunquestionablycytogeneticistphotosynthesisthermodynamicsconservativelychemosynthesispsychoneuroticembarrassinglynarcosynthesisdimensionalityinsufficientlyconstructivelyunsynchronizedinconsiderablypyelonephritisostentatiouslypsychoneurosisphotosyntheticunsuspectinglymysteriousnesschemosynthetichydrocortisoneanesthesiologyunhesitatinglydisconsolatelyconsuetudinarydisingenuouslyabsentmindedlycomprehensibly
...View all with 14 letters...
Phrases (203)
field intensitymoonseed familyyellowish browngenus gossypiumgenus syngoniumcooley's anaemiablended whiskeydrainage systemabstract entitychinese parsley
...View all with 14 letters...
Words (295)
instantaneouslyanaesthesiologyconscientiouslysynergisticallyinaccessibilityoversimplifyingcondescendinglyinfinitesimallyinstrumentalitycontroversiallysuccinylcholineneurophysiologycompassionatelyrecrystallizingphotosynthesizeintrospectivelydemonstrativelyunquestioninglydispassionatelycorrespondinglyunceremoniouslyinconsideratelyneuropsychiatrycomprehensivelysymmetricalnesssystematizationkinestheticallyinsurrectionaryunsymmetricallyadenohypophysishypersensitizeddemonstrabilitycentrosymmetricneurohypophysissidesplittingly
...View all with 15 letters...
Phrases (245)
stay of executionalimentary pasteasamiya languagehelen wills moodydialysis machinegenus sylvilagusgenus bombycillahyoscyamus nigerwassily leontiefsolemnity of mary
...View all with 15 letters...
Words (121)
enthusiasticallyindiscriminatelyirresponsibilityincomprehensiblyquintessentiallyhypersensitivityunprofessionallyconversationallyneuropsychiatrichypersalivationsinextinguishablycommensurabilityhypersensitizinginexhaustibilityunostentatiouslyhyperstimulatinghyperstimulationadministrativelycommonsensicallyhypervitaminosesmalayo-polynesianindiscernibilitymonotheisticallycrossopterygianscryopreservationindispensabilitylyginopteridalesstenographicallyephippiorhynchusflabbergastinglystereophonicallyphotosensitivitycyanocobalaminescyanoethylationscyclohexylamines
...View all with 16 letters...
Phrases (243)
in a beastly mannerstrictly speakingchristian huygenschemical analysisamerican sycamorecarya illinoensissubfamily bovinaenevil shute norwaymechanical systemlaundry stiffener
...View all with 16 letters...
Words (79)
counterinsurgencysuperconductivityneurophysiologistinconsequentiallysocioeconomicallyinterdisciplinaryself-contradictoryisoelectronicallyspondylolisthesishyperstimulationshyperventilationsnonprofessionallyhypnotizabilitiesthrombocytopeniasmonosyllabicitiespaternalisticallyhyposensitizationunderstandabilitycryopreservationscryptocrystallineencephalomyelitispostrevolutionarylymphadenopathiesuncontroversiallyrecrystallizationcytotechnologistsstrongyloidosisesphenylethylaminesdehydrochlorinasesamoyedic-speakingtridimensionalityindestructibilitytriiodothyroninestriphenylmethanesjurisprudentially
...View all with 17 letters...
Phrases (254)
balaena mysticetusinterstate highwaypearly everlastinglycopus americanusmalaysian languagecylinder separatorprimary censorshipcaesarian deliveryinvestment companyanemone sylvestris
...View all with 17 letters...
Words (53)
disproportionatelyinconsequentialityhyperaldosteronismneuropsychologicalhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationnoncomprehensivelysphygmomanometrieshypophysectomizinghyposensitizationscylindrical-stemmedtriphosphopyridinelymphangiographiesrecrystallizationsmagnetostrictivelydehydrochlorinasesdehydrochlorinatestrichloroethylenesgranulocytopoiesesgranulocytopoiesisaerothermodynamicsneurophysiologistsrepresentationallyneuropsychiatristsneuropsychologistsdemythologizationsmethylprednisolonedeoxyribonucleasesincommensurabilitydephosphorylationschlortetracyclinessedimentologicallyphotosynthetically
...View all with 18 letters...
Phrases (254)
worldly possessionsadministrative bodydame sybil thorndikelachrymal secretionfreudian psychologynavigational systemcolumbia universitykilocycle per secondantipsychotic agentgenus chamaecytisus
...View all with 18 letters...
Words (30)
polyesterificationshypersensitizationsextralinguisticallypolyribonucleotidesnonrelativisticallyconceptualisticallycytopathogenicitiesimmunocytochemistryphenomenalisticallyphosphatidylcholinecontradistinctivelythird-dimensionalityhysterosalpingogramthree-dimensionalityimpressionisticallymethylprednisolonesincomprehensibilityencephalomyelitidesdihydrostreptomycindiethylcarbamazinesphytohemagglutininshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminehyperemotionalitiesdimethyltryptaminesexhibitionisticallyexpressionisticallymultidimensionalityPhrases (247)
building supply housejohn millington syngefamily cynoglossidaehydrastis canadensisgiles lytton stracheyzairese monetary unitgenus symphoricarposchinese monetary unitsalicylate poisoninguniversity of chicago
...View all with 19 letters...
Words (24)
uncharacteristicallyoverenthusiasticallyhypersensitivenessesradioimmunoassayablehyperadrenocorticismcytodifferentiationsmagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryencephalomyocarditissyncategorematicallyhyperconsciousnessesdimethylnitrosaminesexistentialisticallyPhrases (205)
william stanley jevonslebanese monetary unitdivision tracheophytabalance sheet analysisbyelorussian languageuniversity of nebraskamechanically skillfulmilton snavely hersheyambystomid salamanderclassification system
...View all with 20 letters...
Words (5)
immunocytochemistriesacetylcholinesterasesotorhinolaryngologiesintersubstitutabilitytetrahydrocannabinolsPhrases (153)
electrolytic condenseraleksandr solzhenitsynmalaysian monetary unitdesoxyribonucleic acidsri lankan monetary unitpseudemys rubriventriseucalyptus fraxinoidescynoglossum officinaleisle royal national parkcapital of pennsylvania
...View all with 21 letters...
Words (2)
intercomprehensibilityencephalomyocarditisesPhrases (158)
lycopersicon esculentumaleksandr i. solzhenitsynloyalist volunteer forcehigh-density lipoproteinrhythm and blues musiciancrescent city connectionsurinamese monetary unitfamily branchiostomidaejohns hopkins universityindonesian monetary unit
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (117)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisparis-sorbonne universitykyrgyzstani monetary unitbangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitor
...View all with 23 letters...
Words (2)
laryngotracheobronchitisphosphatidylethanolaminePhrases (88)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinzollinger-ellison syndromesir terence mervyn rattigandistinguished flying crossalexandre emile jean yersinapocynum androsaemifolium
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (76)
myroxylon balsamum pereiraediamond wedding anniversaryfrancis scott key fitzgeraldedmund john millington syngereligious society of friendsbeggar-my-neighbour strategytrans-alaska pipeline systemsir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (55)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitation
...View all with 26 letters...
Phrases (49)
business environment analysisnikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore pugincommissioned military officernuclear regulatory commissiondeoxyadenosine monophosphatetricyclic antidepressant drugdeoxythymidine monophosphatejames augustine aloysius joyce
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (41)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngercardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitymaster of arts in library sciencedissident irish republican army
...View all with 28 letters...
Phrases (25)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemmiddle east respiratory syndromehydrangea macrophylla hortensis
...View all with 29 letters...
Phrases (27)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepository financial institutionbalance of international paymentswaterhouse-friderichsen syndromesevere acute respiratory syndrome
...View all with 30 letters...
Phrases (12)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activityhuygens' principle of superpositiondefense information systems agency
...View all with 31 letters...
Phrases (20)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovnonsteroidal anti-inflammatory druguniversity of california at berkeleytheory of electrolytic dissociationlymphocytic choriomeningitis virus
...View all with 32 letters...
Phrases (13)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (9)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicehereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeunited states naval research laboratoryPhrases (9)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (12)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausenus army criminal investigation laboratory
...View all with 37 letters...