Select a search method
Start letters
End letters
Use underscore '_' for wildcard/blank. Comma ',' for any order.eg. 'CAN' matches Cane, Scan | 'C,A,N' matches Acne
    Dictionary Only:
    Profanity Off:

    Words Containing: I,N,K,E,Y,E

     (In Any Order)
    There are 68 words, 246 phrases and 0 abbr's with I,N,K,E,Y,E in.
    Jump to: 7 Letters8 Letters9 Letters10 Letters
    Did you mean?
    Containing INKEYE (in order)Anagrams of INKEYE

    Best Scoring Words With: I,N,K,E,Y,E

    		More words
    Expand?WordSave?LengthUsagePointsType
    eyewink7
    		17 verb, nounv, n
    Valid word for Scrabble US
    pinkeye7
    		16 nounn
    noun

    • inflammation of the conjunctiva of the eye

    or scroll down to see all results...
    Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

    7 Letter Words

    Words (3)
    pinkeyeeyewinkkeyline

    8 Letter Words

    Words (5)
    eyewinksrekeyingeyeblinkpinkeyeskeylines
    Phrases (1)
    eye blink

    9 Letter Words

    Words (5)
    keynesianeyeblinkshoneylikereekinglykeelyvine
    Phrases (1)
    kidney pie

    10 Letter Words

    Words (5)
    pernicketyperjinketykidneylikepikeblennykeelyvines
    Phrases (2)
    kidney fernkidney bean

    11 Letter Words

    Words (13)
    yellowknifepersnicketymonkeyshinehyperlinkedchimneylikecytokinesescockneyfiedcockneyfiesyuckinessesteknonymiespennywinklefernyticklepyrokineses
    Phrases (5)
    annie oakleywhiskey neatkidney stoney-linked genekidney vetch

    12 Letter Words

    Words (11)
    hyperkinetichyperkineseshyperkinesiamonkeyshineshyperkinesiskaryokineseskeynesianismpennywinklesladylikenessfernytickleskidney-shaped
    Phrases (9)
    risky ventureblink of an eyealfred kinseydonkey enginekey signaturespider monkeymickey mantlemonkey bridgedonkey boiler

    13 Letter Words

    Words (7)
    rekeyboardinghyperkinesiaspsychokineseskindheartedlykitty-corneredkenyapithecuskinesitherapy
    Phrases (12)
    three kings' daykillarney fernblended whiskykinetic energykinetic theorynew york minutebrake cylinderice-hockey rinksilky anteaterkidney begonia ...
    View all with 13 letters...

    14 Letter Words

    Words (5)
    velvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketone
    Phrases (13)
    dimethyl ketoneblended whiskeydynamic speakerhenry kissingersleepy sicknessmonkey businessearly wake-robinsquirrel monkeybyzantine greekgenus pinckneya ...
    View all with 14 letters...

    15 Letter Words

    Words (9)
    heartbreakinglykinestheticallyphenylketonurictelekineticallyphenylketonuriakenogeneticallypoverty-strickenhuckleberryingsdiphenylketones
    Phrases (18)
    security blanketgenus myxinikelasprinkler systempinckneya pubenshuckleberry finnrepublic of kenyastinking mayweedkeyhole necklinenickel-base alloypurkinje's system ...
    View all with 15 letters...

    16 Letter Words

    Words (4)
    kinaestheticallyphenylketonuriasphenylketonuricsknowledgeability
    Phrases (14)
    friendly takeoverfamily gekkonidaeelwyn brooks whitepresident kennedyyellowfin croakersnowy tree cricketproperly speakingbenjamin kubelskywhite honeysucklehenry bolingbroke ...
    View all with 16 letters...

    17 Letter Words

    Words (1)
    samoyedic-speaking
    Phrases (18)
    greek monetary unithenry louis menckenandrei voznesenskypresident mckinleymonocytic leukemiajacquinia keyensisamerican turkey oaksteak and kidney piehoneysuckle familynickel-iron battery ...
    View all with 17 letters...

    18 Letter Words

    Phrases (22)
    dame sybil thorndikekilocycle per secondkeyboard instrumentkenyan monetary unititalian honeysuckleblack-eyed susan vinemonocytic leukaemiagenus kenyapithecusafrican green monkeywankel rotary engine ...
    View all with 18 letters...

    19 Letter Words

    Phrases (21)
    alben william barkleyturkmen monetary unitgerard manley hopkinsmickey charles mantlekate o'flaherty chopinembryoma of the kidneydisk operating systemkayser-fleischer ringfamily dicksoniaceaearthur edwin kennelly ...
    View all with 19 letters...

    20 Letter Words

    Phrases (20)
    university of nebraskayellow-leaf sickle pinebluethroat pikeblennysnake's head fritillarykinetic theory of gasesklinefelter's syndromemacroclemys temminckihenry alfred kissingerhyperkinetic syndromeprince fumimaro konoye ...
    View all with 20 letters...

    21 Letter Words

    Phrases (13)
    aleksandr solzhenitsynsoren aabye kierkegaardjohn fitzgerald kennedysir john cowdery kendrewpresident john f. kennedythin-leaved stringybarkketamine hydrochlorideharley granville-barkeraustralian honeysucklecyclic redundancy check ...
    View all with 21 letters...

    22 Letter Words

    Phrases (13)
    aleksandr i. solzhenitsynedward kennedy ellingtonpearl sydenstricker buckdouble-entry bookkeepinghydraulic brake cylindersingle-entry bookkeepingbyzantine greek languagegroundbreaking ceremonyisle royale national parkarcuate vein of the kidney ...
    View all with 22 letters...

    23 Letter Words

    Phrases (16)
    family threskiornithidaeyellowstone national parksouth korean monetary unittyrosine kinase inhibitoruzbekistani monetary unityuri alekseyevich gagarinauto-blocking belay devicefriedrich august von hayektheory of weak interactionwernicke's encephalopathy ...
    View all with 23 letters...

    24 Letter Words

    Phrases (5)
    division heterokontophytaandrei andreyevich gromykoanatoli yevgenevich karpovarcuate artery of the kidneydavid lewelyn wark griffith

    25 Letter Words

    Phrases (9)
    francis scott key fitzgeraldtrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskypodkamennaya tunguska rivermikhail yurievich lermontovchamaecyparis nootkatensischronic myelocytic leukemiarocky mountain spotted fever

    26 Letter Words

    Phrases (2)
    employee stock ownership planchronic lymphocytic leukemia

    27 Letter Words

    Phrases (8)
    nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkouniversity of nebraska-lincolnkennedy international airporteysenck personality inventorykepler's law of planetary motion

    28 Letter Words

    Phrases (4)
    aleksandr feodorovich kerenskymicrosoft disk operating systemcount lev nikolayevitch tolstoyrocky mountain bristlecone pine

    29 Letter Words

    Phrases (3)
    aleksandr nikolayevich scriabinlydia kamekeha paki liliuokalanialfred habdank skarbek korzybski

    30 Letter Words

    Phrases (1)
    technical analysis of stock trends

    32 Letter Words

    Phrases (7)
    nikolai andreyevich rimski-korsakovweakly interacting massive particlesergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovuniversity of california at berkeleyyevgeni aleksandrovich yevtushenkojohn f. kennedy international airport

    33 Letter Words

    Phrases (1)
    konstantin sergeyevich stanislavsky

    35 Letter Words

    Phrases (1)
    national socialist german workers' party

    36 Letter Words

    Phrases (1)
    jakob ludwig felix mendelssohn-bartholdy

    37 Letter Words

    Phrases (1)
    karl friedrich hieronymus von munchhausen

    39 Letter Words

    Phrases (1)
    enzyme-linked-immunosorbent serologic assay

    40 Letter Words

    Phrases (2)
    regents of the university of california v. bakkeinternational relations and security network

    43 Letter Words

    Phrases (1)
    international society for krishna consciousness

    48 Letter Words

    Phrases (1)
    royal society of london for improving natural knowledge
    WordDB Icon
    WordDB
    United Kingdom
    Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
    1.
    Tap on share button
    2.
    Tap on Add To Home Screenadd button
    3.
    Find WordDB App Icon on your home screen