Words Containing: I,N,F,I,D,E,L
(In Any Order)
There are 250 words,
999 phrases and
0 abbr's with
I,N,F,I,D,E,L in.
Best Scoring Words With: I,N,F,I,D,E,L
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| finalized | 9 | 22 | verb, adjectivev, adj | |||||
verb • make final; put the last touches on; put into final form | ||||||||
| fiendishly | 10 | 20 | adverb, adjectiveadv, adj | |||||
adverb • as a devil; in an evil manner | ||||||||
| distelfink | 10 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| definitely | 10 | 17 | adverbadv | |||||
adverb • without question and beyond doubt | ||||||||
| infidelity | 10 | 17 | nounn | |||||
noun • the quality of being unfaithful | ||||||||
| friendlily | 10 | 17 | adverb, adjectiveadv, adj | |||||
adverb • In a friendly manner; like a friend; warmly; kindly. | ||||||||
| defilading | 10 | 16 | verbv | |||||
verb • To fortify (something) as a protection from enfilading fire. | ||||||||
| minefields | 10 | 16 | nounn | |||||
noun • a region in which explosives mines have been placed | ||||||||
| girlfriend | 10 | 15 | nounn | |||||
noun • any female friend • a girl or young woman with whom a man is romantically involved | ||||||||
| minefield | 9 | 15 | nounn | |||||
noun • a region in which explosives mines have been placed | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (34)
springfieldinfiltratedunqualifiedfriendliestindefinableuncalcifieddefoliatingdeficientlymisfieldingunclarifiedgrainfieldsdefoliationgirlfriendsunamplifieddistelfinksdiffidentlysolemnifieddeadliftingfeudalizingblindfishesindefinablygoldfinniesdisfleshingdignifiedlyfloxuridineinfibulatedinfieldsmaninfieldsmenflindersiasself-windingfeudalisingdefiliationfidgetinglyunliquefiedPhrases (11)
film editingfield lupinefield rationflying fieldfacial indexfin-de-sieclefinal periodflip one's lidindex fossilfalse indigo
...View all with 11 letters...
Words (44)
confidentialindefinitelydefinitivelydifferentialidentifiablefriendlinessindefensibleunfertilisedunclassifiedunaffiliateddorsiflexionidentifiablyunfertilizedfederalizingindefensiblyindefeasibleinfidelitiesinterfoldingdefinitionallifeguardingindefectiblydemulsifyinginfantilizeddefoliationssulfadiazineindefeasiblyindefectibledecalcifyingindefinablesdefinabilityinfantiliseddisfluenciesinformidablesanctifiedlyfringillidae
...View all with 12 letters...
Phrases (15)
linden familycivil defensefreudian slipkilling fieldline of creditplaying fieldrifleman birdenfilade firefield spanielseminal fluid
...View all with 12 letters...
Words (43)
indefatigableindifferentlysulfanilamidefictionalizedunfriendliestunqualifiedlyindefatigablyresolidifyingsulfadiazinesdesulfurizingnonaffiliateddeclassifyingfictionalisedunelectrifiedfeudalizationrefundabilitydeformalizingdolphinfishesdifferentialsnondiffusiblenonclassifieddefensibilitysulfadimidineself-digestionself-directiondesulfurisingunfeudalisinginfundibulateself-inductiondeformalisingdelirifacientunfeudalizingdifficultnessdefeudalisingsulfapyridine
...View all with 13 letters...
Phrases (25)
field of visionfinal decisioncliff dwellinghenry fieldingin and of itselfline of destinyblennioid fishpine leaf aphidfamily manidaemagnetic field
...View all with 13 letters...
Words (28)
confidentiallyunidentifiabledefibrillationunderqualifieddifferentiallyunfriendlinessdefibrillatingfederalizationdisdainfulnessfractionalizedfieldstrippingsulfanilamidesindefinabilitydifferentiableunderinflationfriendlinessesfeudalizationssulfadimidinesself-disciplineantifederalistnimble-fingereddelirifacientsfractionalisedmodifiablenessdiffusiblenessfederalisationfeudalisationsdefinabilitiesPhrases (33)
protein foldinglobe-finned fishfield intensityintake manifoldindigofera anilfamily tineidaefamily tingidaefamily dacninaeredfin pickerelfamily danaidae
...View all with 14 letters...
Words (26)
confidentialitynonconfidentialrefundabilitiesdesulfurizationdecalcificationdefensibilitiesunderinflationsdefibrillationsindefeasibilityfederalizationsindefectibilityindefensibilityindefinablenessself-descriptionself-disciplineddesulfurisationantifederalistsfour-dimensionalself-opinionatedunderfulfillinginterinfluencedcentrifugalisedcentrifugalizedunqualifiednessfederalisationsdemulsificationPhrases (63)
family tinamidaedefinite articleline of longitudefamily balanidaefriedrich engelsfamily bufonidaefamily neritidaefamily hominidaefamily cinclidaefamily congridae
...View all with 15 letters...
Words (13)
fundamentalisticdisdainfulnessesself-depreciationindefatigabilitydecalcificationsresolidificationprofessionalizeddesulfurizationsindefinabilitiesdeclassificationself-aggrandisingself-aggrandizingunfriendlinessesPhrases (77)
family cyprinidaebill of indictmentdefinite integralcapital of icelandcapital of irelandfield of operationfamily balaenidaefamily blenniidaefamily pythonidaefamily buccinidae
...View all with 16 letters...
Words (11)
self-determinationindefatigablenessconfidentialitiesdeclassificationsresolidificationsindefeasibilitiesindefectibilitiesindefensibilitiesindefinablenessesdifferentiabilityself-contradictionPhrases (91)
interstitial fluidfield of operationsline of merchandiseindefinite articlefamily engraulidaesubfamily turdinaefamily erinaceidaecapital of red chinadisability benefitlimanda ferruginea
...View all with 17 letters...
Words (1)
dichlorodifluoromethanePhrases (43)
family threskiornithidaeclassified advertisementgottfried wilhelm leibnizarticles of confederationamerican federalist partylarge indefinite quantityoxford english dictionaryeriodictyon californicumnewton's third law of motionlepidothamnus laxifolius
...View all with 23 letters...
Words (1)
dichlorodifluoromethanesPhrases (40)
unidentified flying objectdistinguished flying crossadolf otto reinhold windauscapital of northern irelandgottfried wilhelm leibnitzapocynum androsaemifoliumrichard buckminster fullerfluoxetine hydrocholoridebiological warfare defensechristian friedrich hebbel
...View all with 24 letters...
Phrases (29)
count ferdinand von zeppelincluster of differentiation 4francis scott key fitzgeraldnational science foundationfriedrich wilhelm nietzscherudolf christian karl dieselreligious society of friendscharles frederick menningerlepidocybium flavobrunneumcluster of differentiation 8
...View all with 25 letters...
Phrases (16)
policing and enforcement costunited nations children's fundindirect immunofluorescenceconjunctival layer of eyelidsuniformly decelerated motionfriedrich wilhelm von steubendorotheanthus bellidiformisforce-feed lubricating systemdewey decimal classificationbetty naomi goldstein friedan
...View all with 26 letters...
Phrases (16)
partial differential equationholy roman emperor frederick iicommissioned military officerfalkland islands monetary unitaleksandr porfirevich borodinrepublic of trinidad and tobagoadeline virginia stephen woolfpetrified forest national parkequivalent-binary-digit factoru.s. national library of medicine
...View all with 27 letters...
Phrases (16)
third council of constantinoplecapital of serbia and montenegrodemocratic republic of the congofederal housing administrationludwig josef johan wittgensteincoronoid process of the mandiblenonsteroidal anti-inflammatoryautodefensas unidas de colombiafield-sequential color tv systemfreedom from self-incrimination
...View all with 28 letters...
Phrases (15)
second council of constantinoplecapital of the dominican republiccapital of the russian federationfrancisco jose de goya y lucientesdirector of central intelligencetheory of punctuated equilibriumpressure-feed lubricating systemcombined transport bill of ladingfederal aviation administrationmanuel rodriquez patriotic front
...View all with 29 letters...
Phrases (14)
department of energy intelligencedepository financial institutionvicomte ferdinand marie de lessepsrepublic of bosnia and herzegovinaaugust friedrich leopold weismannalessandro di mariano dei filipepifield-sequential color televisionvena dorsalis clitoridis profundatechnical analysis of stock trendsrevelation of saint john the divine
...View all with 30 letters...
Phrases (12)
bureau of intelligence and researchfreedom from involuntary servitudesir john frederick william herschelfrances elizabeth caroline willardislamic great eastern raiders-frontfemale internal reproductive organrank-order correlation coefficientoscar fingal o'flahertie wills wildefederal communications commissionovulation method of family planning
...View all with 31 letters...
Phrases (8)
musical instrument digital interfacebreach of trust with fraudulent intentcongress of industrial organizationsnondepository financial institutiondisease of the neuromuscular junctionunited self-defense forces of colombiadefense technical information centerphysiological jaundice of the newbornPhrases (9)
confidential adviser-advisee relationfederal national mortgage associationacademy of television arts and sciencesfriedrich august kekule von stradonitzhermann ludwig ferdinand von helmholtzclostridium perfringens epsilon toxinfederal deposit insurance corporationunited states fish and wildlife servicerevolutionary armed forces of colombiaPhrases (10)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdychurch of jesus christ of latter-day saintsfield-sequential color television systemcriminal intelligence services of canadavenae dorsales clitoridis superficialesbaron karl maria friedrich ernst von weberdeclining balance method of depreciationnaval air warfare center weapons divisionPhrases (9)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencegates of the arctic national park and preservefuerzas armadas revolucionarios de colombiabaron hermann ludwig ferdinand von helmholtz
