Words Containing: I,L,P,Y
(In Any Order)
There are 4,591 words,
2,610 phrases and
0 abbr's with
I,L,P,Y in.
Best Scoring Words With: I,L,P,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| oxyphil | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| jumpily | 7 | 21 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| jimply | 6 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
| pawkily | 7 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| prickly | 7 | 18 | adjectiveadj | |||||
adjective satellite • very irritable • having or covered with protective barbs or quills or spines or thorns or setae etc. | ||||||||
| glyphic | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| puffily | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| pockily | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| happily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in a joyous manner • in an unexpectedly lucky way | ||||||||
| amplify | 7 | 17 | verbv | |||||
verb • increase in size, volume or significance • to enlarge beyond bounds or the truth • exaggerate or make bigger • increase the volume of | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
pilyWords (104)
playingtypicalhappilydisplayrapidlyolympicplainlypricklyolympiayelpingpyloricpaisleypilloryamplifyspindlyairplayslipwayprivilypiouslypillowyemptilycrisplysylphidpayslipineptlymisplaytepidlypyralidpliancysylphicpithilypliablypudgilyphonilypriorly
...View all with 7 letters...
Phrases (3)
h. pyloriyield uplily padWords (224)
possiblyphysicalolympicsslipperyapplyingpubliclymultiplypolitelyimplyingsyphilisepilepsyponytailplaytimeladyshipsimplifystupidlypriestlypolarityolympiadatypicalpalimonyprincelyolympianplaygirlplaylistpleurisyspeedilyphysaliaprettilysleepilyplaysuitimpishlysportilydiphenylplaybill
...View all with 8 letters...
Phrases (12)
pay claimpond lilyplay listlindy hopslip awaypine lilyptolemy ilily ponslucky dippink lady
...View all with 8 letters...
Words (363)
preciselypublicityspeciallyspecialtyprivatelytypicallyprimarilypartiallyparalysisdisplayedpatientlypainfullydiplomacysupplyingunhappilyplaythingparalyticpolynesiapyramidalpassivelypygmalionsprightlylymphaticcapillarysparinglypitifullyinterplaycomplyingphilologyduplicitypointedlyspatiallyparleyingpapillarypalmistry
...View all with 9 letters...
Phrases (22)
wild pansyswamp lilyemily postwiley postpineal eyeivory palmparty girldirty poolparty linehyssop oil
...View all with 9 letters...
Words (523)
especiallyphilosophyphysicallypreviouslypositivelypopularitysimplicityspecialitycomplexitycapabilityphysiologycomplicityexplicitlyplaywrightpiccadillypolyphonicsplendidlypainlesslyimproperlyimpossiblyimplicitlyimpeccablyproximallyprofitablypolycyclicsheepishlypolynesianlycopodiumepicondyleprofligacyparalysingperilouslyhieroglyphpolygamistpoetically
...View all with 10 letters...
Phrases (44)
field pansypineal bodypalm familyspanish flyoil companypink familyglyptic artfloppy diskolympic godplay tricks
...View all with 10 letters...
Words (632)
possibilitypersonalitypracticallyimportantlytemporarilyhospitalitypoliticallypreliminarypotentiallyprobabilitycalligraphyspirituallypunctualitypsychedelicapocalypticmultiplyingresponsiblypolytechnicimpatientlypyroclasticprincipallyimpulsivelydeceptivelyappallinglypredictablyplaywritingpolymorphicsphericallyexpedientlysimplifyingphysicalityexpensivelyexplosivelypeculiarityculpability
...View all with 11 letters...
Phrases (63)
body politicplaying areaspecial jurypussy willowrunning playpiano playerpolicy makerbully pulpitdisplay caselamp chimney
...View all with 11 letters...
Words (645)
particularlyspecificallypsychologistsurprisinglypennsylvaniadisciplinarypassionatelyhypocriticalspiritualitymunicipalityencyclopediahypotheticalmetaphysicalparamilitarysuspiciouslyperiodicallypatheticallyinexplicablyanaphylacticrespectivelyperipherallyhieroglyphicpersistentlytriumphantlytheophyllinepolysyllabichypochloriteemphaticallyphilanthropycompulsivelyegyptologistadaptabilityprecariouslyimpartialityprophylactic
...View all with 12 letters...
Phrases (120)
molly pitcherlickety splitshaking palsyathletic typephantasy lifeplantain lilyacrylic paintpolicy changedramatic playtennis player
...View all with 12 letters...
Words (664)
psychologicalapproximatelyexceptionallyindependentlyappropriatelycomplimentaryimpossibilityparliamentaryprogressivelyhieroglyphicsphysiologicalcompatibilitypredominantlyexponentiallyimprobabilityparadoxicallycomparativelystereotypicalpainstakinglyirresponsiblysuperficiallyconspicuouslyimperceptiblyencyclopaediahypoglycaemicpreliminarilyneurosyphilisparticularitydependabilitycompetitivelyprofitabilityprovisionallyprovocativelypredominatelyhypercalcemia
...View all with 13 letters...
Phrases (112)
family picidaefamily poaceaeplum-yew familyheavy particlecocktail partyamyloid plaquepays de la loirelivery companylatency periodprinted symbol
...View all with 13 letters...
Words (525)
responsibilityprofessionallyhypotheticallypsychoanalysismetaphoricallyrespectabilitygeographicallyalphabeticallyinterplanetarypathologicallyhyperventilateproportionallypsychoanalyticpredictabilitysusceptibilityexperimentallymetaphysicallytelepathicallyreproductivelydiplomaticallyoptimisticallyappreciativelysuperficialitypolymerizationsimplisticallypyelonephritisprovidentiallyorthopedicallyimpracticalityarchetypicallybiographicallyunsuspectinglytelephonicallypreferentiallynymphomaniacal
...View all with 14 letters...
Phrases (177)
family apiaceaepearl mae baileypituitary glandcapital of italycapital of kenyavisual propertycapital of libyapolymeric amidetypha latifoliachinese parsley
...View all with 14 letters...
Words (383)
psychologicallyinappropriatelyphysiologicallydisrespectfullyphilosophicallyincompatibilityoversimplifyingsurreptitiouslyparentheticallypsychobiologistplenipotentiarysuppositionallymicroscopicallyproportionatelycardiopulmonarytherapeuticallydisappointinglyinconspicuouslyneurophysiologycompassionatelyuncomplimentarymethylphenidatepostoperativelyintrospectivelyunparliamentaryproportionalityuninterruptedlyunacceptabilityinspirationallyhypochondriacalsympatheticallydispassionatelycorrespondinglyretrospectivelydemographically
...View all with 15 letters...
Phrases (225)
alimentary pastefamily leporidaepsychotic beliefstonecrop familyfamily lophiidaepipeline companybroomrape familylymphatic vesselcapital of norwayinsurance policy
...View all with 15 letters...
Words (203)
irresponsibilityincomprehensiblycatastrophicallytriphenylmethanehyperintelligentunpredictabilityhyperventilationpsychoanalyticalphylogeneticallyimperceptibilityuncompromisinglypsychophysiologypharmaceuticallyunapologeticallypsychobiologicalphotographicallyunprofessionallyparapsychologistincorruptibilitypolydispersitieshypersalivationsparadigmaticallypornographicallyantistrophicallyspondylarthritisparamagneticallyradiographicallynoncompetitivelyhypersexualitiespolyphyleticallypolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulation
...View all with 16 letters...
Phrases (210)
hypodermic needlestrictly speakingfamily cyperaceaefamily cyprinidaecapital of hungaryin all probabilitypodocarpus familycalystegia sepiumprotoctist familycapital of new york
...View all with 16 letters...
Words (122)
anthropologicallyneurophysiologistphilanthropicallypsycholinguisticsmultidisciplinaryprobabilisticallyinterdisciplinarycercidiphyllaceaekaleidoscopicallyspondylolisthesisradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionallyhypnotizabilitieshypochondriacallypaternalisticallypathophysiologiesmorphogeneticallylexicographicallycryptocrystallineencephalomyelitiscrystallographiespostrevolutionarymicropaleontologydisrespectabilitytranscriptionallylymphadenopathieshyperalimentationlymphangiographictransdisciplinarycyclophosphamides
...View all with 17 letters...
Phrases (272)
mary leontyne pricesalvia leucophyllaproteolytic enzymelycopodium alpinumhypoglycemic agentpearly everlastingfamily dasypodidaelycopus americanussubphylum craniatacapital of kentucky
...View all with 17 letters...
Words (62)
disproportionatelyhypercoagulabilitypsychopathologicalhyperaldosteronismsociopsychologicalneuropsychologicalpolyesterificationspectroheliographypolyribonucleotidenoncomprehensivelypathophysiologicallaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographieshyperbilirubinemiastereospecificallyautobiographicallymucopolysaccharidehypercholesteremiamyeloproliferativephenomenologicallyophthalmologicallysubmicroscopicallyoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesispolypropenonitrileneurophysiologistsrepresentationallyelectromyographiesneuropsychologistsmetallographicallyhistocompatibility
...View all with 18 letters...
Phrases (239)
worldly possessionsrevolutionary groupfamily physeteridaefreudian psychologypodilymbus podicepsread-only memory chipkilocycle per secondsuperiority complexfamily asparagaceaefamily polygalaceae
...View all with 18 letters...
Words (48)
psychophysiologicalcinematographicallypolyesterificationspolyribonucleotideshypersusceptibilityhypolipoproteinemiaparthenogeneticallymucopolysaccharideslipopolysaccharidesconceptualisticallybacteriochlorophyllpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallyphosphatidylcholineinterdepartmentallyhysterosalpingogramimpressionisticallyelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistanthropocentricallyanthropomorphicallyelectroretinographyincomprehensibilitycortico-hypothalamicencephalomyelitideshistopathologicallyphenylpropanolaminehistoriographicallyoverproportionatelypsychopharmacologicsymptomatologically
...View all with 19 letters...
Phrases (228)
building supply housewater-plantain familyfamily cyclopteridaealpine type of glacierphytolacca americanafamily lepisosteidaefamily dasyproctidaecapital of kyrgyzstanfamily tropaeolaceaefamily polypodiaceae
...View all with 19 letters...
Words (29)
hypercholesterolemiapolyphiloprogenitivelipochondrodystrophycrystallographicallylymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesoophorosalpingectomyphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallyhistoincompatibilityultramicroscopicallyelectrophysiologicalelectrophysiologistsroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationpsychopathologicallypsychopharmacologiesmicrophotometricallypsychopharmacologisthypercholesterolemichypercoagulabilitiesplethysmographicallyPhrases (191)
wyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaemarchantia polymorphadianthus caryophyllusfamily pseudococcidaefriendly relationshipamyloid protein plaquepolitically incorrectglycerol tripalmitate
...View all with 20 letters...
Words (14)
psychopharmacologicalhypogammaglobulinemiahypersusceptibilitiesstereomicroscopicallymucopolysaccharidosiselectromyographicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallyPhrases (170)
eucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaarctostaphylos uva-ursiptolemy ii philadelphusspectroscopic analysisprocaine hydrochloridefamily myrmecophagidaespeech intelligibilityphylum platyhelminthes
...View all with 21 letters...
Words (5)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyencephalomyocarditisesdihydroxyphenylalaninePhrases (141)
lycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathysodium tripolyphosphatehigh-density lipoproteinathyrium thelypteroidesmale reproductive systematmospheric electricity
...View all with 22 letters...
Words (1)
hypobetalipoproteinemiaPhrases (103)
posterior pituitary glandmeperidine hydrochlorideyellowstone national parkcanyonlands national parkdorothy rothschild parkersciadopitys verticillatatricyclic antidepressanthydrophyllum virginianumeastern malayo-polynesiansir anthony philip hopkins
...View all with 23 letters...
Words (4)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (64)
privately held corporationapocynum androsaemifoliumexistentialist philosophyfederal republic of germanychrysosplenium americanumhaematoxylum campechianumanal retentive personalityoxidative phosphorylationelectroconvulsive therapypaul johann ludwig von heyse
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (39)
myroxylon balsamum pereiraesymphoricarpos orbiculatuspropoxyphene hydrochloridepolystichum acrostichoidescaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinmichelson-morley experimentconstant of proportionalitylepidocybium flavobrunneum
...View all with 25 letters...
Phrases (36)
employee stock ownership planbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosuscalycophyllum candidissimumscardinius erythrophthalmussuperorder labyrinthodontianontricyclic antidepressant
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (30)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanatricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteintopical prostaglandin eyedrop
...View all with 27 letters...
Phrases (20)
revolutionary people's struggleephippiorhynchus senegalensistriphosphopyridine nucleotidecardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armyrevolutionary proletarian armysmall computer system interfacesingle nucleotide polymorphismimperial japanese morning glory
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (16)
antisocial personality disorderinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibriumanonymous file transfer protocolpressure-feed lubricating system
...View all with 29 letters...
Phrases (20)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentspolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalifornia personality inventory
...View all with 30 letters...
Phrases (9)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economysubacute inclusion body encephalitisphysiological jaundice of the newborn
