Words Containing: I,L,N,P,Y
(In Any Order)
There are 1,786 words,
1,513 phrases and
0 abbr's with
I,L,N,P,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
phonily | 7 | 15 | adjectiveadj | |||||
adverb • In a phony way, or to a phony extent | ||||||||
polynyi | 7 | 15 | ||||||
Valid word for Scrabble US
| ||||||||
pinkly | 6 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
pliancy | 7 | 14 | nounn | |||||
noun • the property of being pliant and flexible • adaptability of mind or character | ||||||||
nippily | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
playing | 7 | 13 | verb, adjectivev, adj | |||||
noun • the act of playing a musical instrument • the action of taking part in a game or sport or other recreation • the performance of a part or role in a drama | ||||||||
yelping | 7 | 13 | verb, noun, adjectivev, n, adj | |||||
noun • a sharp high-pitched cry (especially by a dog) | ||||||||
spindly | 7 | 13 | adjectiveadj | |||||
adjective satellite • long and lean | ||||||||
ploying | 7 | 13 | verbv | |||||
Valid word for Scrabble US
| ||||||||
plainly | 7 | 12 | adverb, adjectiveadv, adj | |||||
adverb • unmistakably (`plain' is often used informally for `plainly') • in a simple manner; without extravagance or embellishment | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
plinyWords (50)
applyingimplyingponytailpalimonyprincelyolympiandiphenyllynchpinlinotypesplayingreplyingsnoopilysupinelygapinglybiphenylpenalitysnippilyspongilyptyalinspliantlypryinglyspoonilymopinglyphenylicalpinelyposinglypolyenicplyinglypipinglypalsyingjapinglyunripelypunchilysnappilyspinally
...View all with 8 letters...
Phrases (5)
pond lilylindy hoppine lilylily ponspink ladyWords (112)
patientlypainfullysupplyingunhappilyplaythingpolynesiapygmalionsparinglyinterplaycomplyingpointedlyparleyingpainterlypolygenicflippancypensivelyhyperlinkpolyvinyluntypicalpityinglypyroxylinbumpkinlyraspinglyweepinglyhypnoidallimpinglynuptiallyparlayingpoutinglypolymyxinspringilypantinglylynchpinsplenarilyamylopsin
...View all with 9 letters...
Phrases (4)
wild pansypineal eyeparty linefly poisonWords (176)
polyphonicsplendidlypainlesslypolynesianepicondyleparalysingamplifyingintrepidlyunpriestlytrippinglypoignantlyimpudentlyplayactingpleasinglyreapplyingsportinglypsilocybininexpertlyspankinglygrippinglypuzzlinglypolynomialflippantlytemptinglypiercinglypunitivelyimposinglyimpotentlypenitentlyanaglyphicsynopticalplaymakingpolyolefinpilloryingnuptiality
...View all with 10 letters...
Phrases (18)
field pansypineal bodyspanish flyoil companypink familypine familyruby spineltyping poolivory plantparty liner
...View all with 10 letters...
Words (222)
personalityimportantlypreliminarypotentiallypunctualitymultiplyingresponsiblypolytechnicimpatientlyprincipallyappallinglyplaywritingexpedientlysimplifyingexpensivelyrhinoplastyprominentlyxylophonistangioplastypointlesslyinescapablyunsparinglyroleplayingplentifullyplaintivelypromisinglyanaphylaxisnonphysicalimprudentlyperenniallyspondylitisapprovinglyreprovinglyinculpatoryimploringly
...View all with 11 letters...
Phrases (29)
playing arearunning playpiano playerlamp chimneypassion playpearl hominystay in placefilm companyplayer pianoblood typing
...View all with 11 letters...
Words (246)
surprisinglypennsylvaniadisciplinarypassionatelymunicipalityencyclopediainexplicablyanaphylacticpersistentlytriumphantlytheophyllinephilanthropyproficientlycompellinglyphylogeneticprincipalityindisputablyparalyzationphoneticallypotentialitydepressinglydespairinglyencyclopedicincomparablyplatonicallyhypnoticallylycanthropichypnotisableimpersonallyexemplifyinghydroplaningcontemptiblyincapabilitypedanticallyunpopularity
...View all with 12 letters...
Phrases (61)
shaking palsyphantasy lifeplantain lilyacrylic paintpolicy changetennis playerpetit larcenytenpenny naildisplay panelplatonic body
...View all with 12 letters...
Words (265)
exceptionallyindependentlycomplimentaryparliamentarypredominantlyexponentiallypainstakinglyirresponsiblyconspicuouslyencyclopaediapreliminarilyneurosyphilisdependabilityprovisionallypredominatelydisparaginglyincompetentlyinexpensivelypennsylvanianinexpressiblysyphilizationimpertinentlyunimpeachablypretentiouslyunpunctualitycryptanalysisendolymphaticpalynologicalpunctiliouslyencyclopaedicunpredictablyproselytizinginopportunelyamitriptylinepenetratingly
...View all with 13 letters...
Phrases (46)
livery companylatency periodprinted symbolleontyne priceflying reptilebesseya alpinayellowish pinkplaying periodcylinder pressoriental poppy
...View all with 13 letters...
Words (241)
responsibilityprofessionallypsychoanalysisinterplanetaryhyperventilateproportionallypsychoanalyticexperimentallypolymerizationpyelonephritisprovidentiallyunsuspectinglytelephonicallypreferentiallynymphomaniacaldisapprovinglyoverpoweringlyunpalatabilitylyophilizationimpregnabilitycomprehensiblycycloparaffinsdepolymerizingsupersonicallypreconsciouslyaminophyllineshypermasculinepolybutadienesprocessionallyhypoallergeniccompensabilitypolynucleotideunflappabilityspellbindinglyunappetizingly
...View all with 14 letters...
Phrases (85)
pituitary glandcapital of kenyachinese parsleylife expectancyrudyard kiplingphylum annelidalaw of parsimonypolyvinyl resinlimited companymalpighian body
...View all with 14 letters...
Words (192)
inappropriatelyincompatibilityoversimplifyingparentheticallyplenipotentiarysuppositionallyproportionatelycardiopulmonarydisappointinglyinconspicuouslyneurophysiologycompassionatelyuncomplimentarymethylphenidateintrospectivelyunparliamentaryproportionalityuninterruptedlyunacceptabilityinspirationallyhypochondriacaldispassionatelycorrespondinglycomprehensivelyperpendicularlycontemptibilitysidesplittinglynonspecificallycontemplativelycomplementarityimponderabilitypsychoanalyzingserendipitouslysycophanticallyincomparability
...View all with 15 letters...
Phrases (118)
alimentary pastestonecrop familypipeline companycapital of norwayinsurance policybrittany spanielaplysia punctatapolyphonic proseapocynum pumilumpolitical entity
...View all with 15 letters...
Words (107)
irresponsibilityincomprehensiblytriphenylmethanehyperintelligentunpredictabilityhyperventilationpsychoanalyticalphylogeneticallyuncompromisinglyunapologeticallyunprofessionallyincorruptibilityhypersalivationspornographicallyantistrophicallyspondylarthritisparamagneticallynoncompetitivelyhyperstimulatinghyperstimulationantiunemploymentpolysynapticallyhyperventilatingmalayo-polynesianmonopolisticallynonpsychologicalmonosynapticallyhemoglobinopathyperpendicularityiconographicallypostpositionallyindispensabilitylyginopteridalesstenographicallypostsynaptically
...View all with 16 letters...
Phrases (107)
hypodermic needlestrictly speakingfamily cyprinidaecapital of hungaryin all probabilitycapital of new yorkpharyngeal tonsilfamily punicaceaefamily pythonidaegrand mal epilepsy
...View all with 16 letters...
Words (66)
anthropologicallyneurophysiologistphilanthropicallypsycholinguisticsmultidisciplinaryinterdisciplinaryspondylolisthesishyperstimulationshyperventilationsnonprofessionallyhypnotizabilitieshypochondriacallypaternalisticallymorphogeneticallycryptocrystallineencephalomyelitispostrevolutionarymicropaleontologytranscriptionallylymphadenopathieshyperalimentationlymphangiographictransdisciplinaryoceanographicallythiodiphenylamineonomatopoeticallytransplantabilityphenylethylaminesnephelometricallyopportunisticallyptilonorhynchidaetriphenylmethaneshyperintelligencejurisprudentiallyneurophysiologies
...View all with 17 letters...
Phrases (154)
mary leontyne priceproteolytic enzymelycopodium alpinumhypoglycemic agentpearly everlastinglycopus americanussubphylum craniatacapital of kentuckycylinder separatorrepublic of hungary
...View all with 17 letters...
Words (32)
disproportionatelyhyperaldosteronismneuropsychologicalpolyesterificationpolyribonucleotidenoncomprehensivelylaryngopharyngitispostpsychoanalyticlymphangiographieshyperbilirubinemiaphenomenologicallygranulocytopoiesesgranulocytopoiesispolypropenonitrileneurophysiologistsrepresentationallyneuropsychologistsmethylprednisolonepropagandisticallydephosphorylationspsychoanalyticallyphotosyntheticallyhyperalimentationssemiprofessionallyphytohemagglutininneurophysiologicaldimethyltryptaminediphenylhydantoinshypernationalisticpolyacrylonitrileshyperpolarizationshyperrationalitiesPhrases (133)
worldly possessionsrevolutionary groupfreudian psychologyread-only memory chipkilocycle per secondinfantile paralysiscapital of new jerseypolish monetary unitrespiratory illnessphoenix dactylifera
...View all with 18 letters...
Words (25)
cinematographicallypolyesterificationspolyribonucleotideshypolipoproteinemiaparthenogeneticallyconceptualisticallypharmacodynamicallyphenomenalisticallyphenylthiocarbamidephosphatidylcholineinterdepartmentallyhysterosalpingogramimpressionisticallymethylprednisolonesanthropocentricallyanthropomorphicallyelectroretinographyincomprehensibilityencephalomyelitidesphenylpropanolamineoverproportionatelyphytohemagglutininshyperemotionalitiesdimethyltryptaminesexpressionisticallyPhrases (133)
building supply housewater-plantain familyalpine type of glacierphytolacca americanacapital of kyrgyzstansalicylate poisoningsymphytum officinalesubfamily mephitinaesubfamily potoroinaehyssopus officinalis
...View all with 19 letters...
Words (14)
polyphiloprogenitivelipochondrodystrophylymphogranulomatosisphenylpropanolaminesphenylthiocarbamidesoophorosalpingectomyphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiahistoincompatibilityroentgenographicallyencephalomyocarditisphotophosphorylationPhrases (111)
marchantia polymorphadianthus caryophyllusfriendly relationshipamyloid protein plaquepolitically incorrectsupplementary benefitnymphicus hollandicusphylogenetic relationpersonality inventorypass with flying colors
...View all with 20 letters...
Words (4)
hypogammaglobulinemiapolyvinyl-formaldehydephotophosphorylationsclinicopathologicallyPhrases (106)
eucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaspectroscopic analysisprocaine hydrochloridespeech intelligibilityphylum platyhelminthesprosopium cylindraceumpercy aldridge graingersuperfamily tyrannidae
...View all with 21 letters...
Words (3)
intercomprehensibilityencephalomyocarditisesdihydroxyphenylalaninePhrases (100)
lycopersicon esculentumredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathyhigh-density lipoproteinparliamentary proceduresamuel pierpoint langleydisplaying incompetencedepartment of philosophyfamily hippocastanaceae
...View all with 22 letters...
Words (1)
hypobetalipoproteinemiaPhrases (74)
posterior pituitary glandmeperidine hydrochlorideyellowstone national parkcanyonlands national parktricyclic antidepressanthydrophyllum virginianumeastern malayo-polynesiansir anthony philip hopkinsamerican federalist partywestern malayo-polynesian
...View all with 23 letters...
Words (2)
hyperbetalipoproteinemiaphosphatidylethanolaminePhrases (45)
privately held corporationapocynum androsaemifoliumexistentialist philosophyfederal republic of germanychrysosplenium americanumhaematoxylum campechianumanal retentive personalityoxidative phosphorylationelectroconvulsive therapypaul johann ludwig von heyse
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (31)
myroxylon balsamum pereiraepropoxyphene hydrochloridetrans-alaska pipeline systempyotr alexeyevich kropotkinmichelson-morley experimentconstant of proportionalitylepidocybium flavobrunneumtympanuchus pallidicinctussubfamily caesalpinioideaecomplementary distribution
...View all with 25 letters...
Phrases (30)
employee stock ownership planentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritycalycophyllum candidissimumscardinius erythrophthalmussuperorder labyrinthodontianontricyclic antidepressantintermediate temporal arterycalifornia single-leaf pinyon
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (21)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanatricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteintopical prostaglandin eyedrop
...View all with 27 letters...
Phrases (18)
revolutionary people's struggleephippiorhynchus senegalensistriphosphopyridine nucleotidecardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armyrevolutionary proletarian armysmall computer system interfacesingle nucleotide polymorphismimperial japanese morning glory
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (16)
antisocial personality disorderinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibriumanonymous file transfer protocolpressure-feed lubricating system
...View all with 29 letters...
Phrases (20)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentspolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalifornia personality inventory
...View all with 30 letters...
Phrases (9)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economysubacute inclusion body encephalitisphysiological jaundice of the newborn