Words Containing: I,L,K,Y
(In Any Order)
There are 525 words,
501 phrases and
0 abbr's with
I,L,K,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
quickly | 7 | 25 | adverbadv | |||||
adverb • with speed • with little or no delay • without taking pains | ||||||||
quakily | 7 | 23 | ||||||
Valid word for Scrabble US
| ||||||||
killjoy | 7 | 21 | nounn | |||||
noun • someone who spoils the pleasure of others | ||||||||
jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
jokily | 6 | 20 | adverb, adjectiveadv, adj | |||||
adverb • In a joky manner; jokingly, humorously. | ||||||||
thickly | 7 | 19 | adverbadv | |||||
adverb • spoken with poor articulation as if with a thick tongue • in a concentrated manner • with a thick consistency • with thickness; in a thick manner • in quick succession | ||||||||
wackily | 7 | 19 | adverb, adjectiveadv, adj | |||||
adverb • in a mildly insane manner | ||||||||
kylix | 5 | 19 | nounn | |||||
noun • a shallow drinking cup with two handles; used in ancient Greece | ||||||||
pawkily | 7 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
prickly | 7 | 18 | adjectiveadj | |||||
adjective satellite • very irritable • having or covered with protective barbs or quills or spines or thorns or setae etc. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (69)
quicklyluckilypricklywrinklyskylinekilljoyshakilythicklybrisklycolickysoymilkcrinklytwinklyslicklywackilylinkboymurkilykylikesivylikealkylicskylikegawkilyeyelikesulkilysnakilyperkilysilkilypeskilyspikilybeyliksraylikeskysailcockilyleakilykinkily
...View all with 7 letters...
Phrases (3)
dry kilndry milkkey limeWords (83)
unlikelyskylightmckinleyladylikejokinglyunkindlyvalkyriewickedlyknightlybiweeklysneakilygarlickykilobyterakishlyspookilykolinskycheekilytrickilyskimpilyfrolickyknottilypluckilyslinkilyswankilykilljoyshymnlikeskylineskailyardrollickyfreakilyfriskilylinkboyssmirkilystockilysnarkily
...View all with 8 letters...
Phrases (12)
eye blinkmilk wheyyak's milkstink flylucky dippink ladysilky elmsilky oakmilky waykudu lily
...View all with 8 letters...
Words (92)
knowinglymockinglyunluckilykimberleyskilfullyjellylikeankylosishyperlinkmawkishlypuppylikeknavishlybumpkinlysylphlikeberrylikepuckishlyquakinglyfairylikesyruplikeirksomelywalkyrieshawkishlygawkishlyankyloticrockinglykiddinglyweakishlywinkinglykillinglylackeyingkilocyclerackinglyjerkinglysketchilystreakilyivorylike
...View all with 9 letters...
Phrases (6)
like crazycity blockmilk yieldrelay linkblink awaysky burialWords (82)
mistakenlybricklayershockinglyskillfullyfreakishlystrikinglyrockabillylawyerlikespankinglylikabilityunladylikealkalinityplaymakingtrickishlyprankishlyskylightedsneakinglythinkinglyalkylatingskittishlyhyperlinksleukocyticperikaryalshylockinglymphokineticklishlykilocyclessemiweeklyskylarkingflunkyismscherrylikejaywalkingclankinglyankylosingkaryologic
...View all with 10 letters...
Phrases (18)
mt. mckinleyisle of skyepink familylady killerfloppy diskplay trickslickety cutalkyd resinivory blacklucky lindy
...View all with 10 letters...
Words (59)
unknowinglyyellowknifehypokalemiahypokalemickinesiologybricklayingsickeninglyskepticallyworkabilitytiddlywinksunthinkablytalkativelyprovokinglyhyperlinkedflyspeckingbankabilitybricklayersalkylationschucklinglychimneylikeplaymakingsalkalimetrylymphokinesbrainsicklyfactorylikelickerishlyalkalifyingtracklayingkaryologieskittenishlypackabilitykineticallychelyabinskpinnywinkletricklingly
...View all with 11 letters...
Phrases (29)
louis leakeylike royaltybilly the kidpolicy makeralkyl halideclosely knittightly knitcelery stickannie oakleyfield hockey
...View all with 11 letters...
Words (46)
unmistakablystanislavskyhyperkalemiaunthinkinglyholidaymakerhyperlinkingunskillfullyunblinkinglyflickeringlybricklayingsleukocytosisdaydreamlikekremlinologydrinkabilityhypokalemiastracklayingskaryologicalgallygaskinspinnywinklesrevokabilityfairnytickleleukocytoticblackish-grayblackish-greypolicy-makingcockyleekiesgreyish-blackrollickinglytiddledywinktiddleywinkspennywinklesladylikenessfernyticklesgrayish-blackpoikilocytes
...View all with 12 letters...
Phrases (33)
lickety splithockey clinicshaking palsyalkyl radicalginkgo familyblink of an eyealfred kinseytake kindly toliterary workplay a trick on
...View all with 12 letters...
Words (25)
painstakinglymarketabilityholidaymakersunworkabilitytiddledywinksunknowabilitykindheartedlykinematicallyunshrinkinglythankworthilyblackberryingfairnyticklesclickety-clackclickety-clickjawbreakinglyremarkabilityunmistakeablyankyloglossiahydraulickingpoikilothermysketchabilitykatabolicallyforeknowinglyprickly-leafedprickly-leavedPhrases (31)
el iskandriyahmount mckinleycocktail partynylon stockingrichard leakeywhiskey bottlesilky wisteriaryukyu islandskillarney fernmollusk family
...View all with 13 letters...
Words (13)
unthinkabilitykaryotypicallybreathtakinglyearthshakinglyhydrokineticalleukocytosisesblackberry-lilyblackberryingsvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketonePhrases (48)
dimethyl ketoneveliky novgorodcapital of kenyablended whiskeyemily dickinsonkyrgyz republicrudyard kiplingbishop berkeleysleepy sicknessfamily akeridae
...View all with 14 letters...
Words (15)
lackadaisicallyheartbreakinglykinestheticallyankylostomiasesankylostomiasisphenylketonuriccholecystokinintelekineticallyphytoplanktonicphenylketonuriaknowledgabilitykenogeneticallylymphoblast-likehuckleberryingsdiphenylketonesPhrases (36)
buckthorn familycapital of turkeydocking facilityalfred korzybskisecurity blanketwilliam mckinleymarketable yieldwilliam shockleygenus myxinikelafield hockey ball
...View all with 15 letters...
Words (6)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsknowledgeabilityPhrases (35)
strictly speakingalan lloyd hodgkincapital of new yorkfriendly takeoverfrank lloyd wrightfamily gekkonidaeelwyn brooks whiterodya raskolnikovyellowfin croakerkerry blue terrier
...View all with 16 letters...
Phrases (10)
holy roman emperor frederick iialeksandr sergeyevich pushkinfalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventorymartin luther king jr's birthdaykepler's law of planetary motionPhrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay