Words Containing: I,K,Y
(In Any Order)
There are 1,098 words,
845 phrases and
0 abbr's with
I,K,Y in.
Best Scoring Words With: I,K,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| zinkify | 7 | 26 | ||||||
Valid word for Scrabble US
| ||||||||
| quickly | 7 | 25 | adverbadv | |||||
adverb • with speed • with little or no delay • without taking pains | ||||||||
| zincky | 6 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| quakily | 7 | 23 | ||||||
Valid word for Scrabble US
| ||||||||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| quirky | 6 | 22 | adjectiveadj | |||||
adjective satellite • (informal) strikingly unconventional | ||||||||
| killjoy | 7 | 21 | nounn | |||||
noun • someone who spoils the pleasure of others | ||||||||
| wickyup | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| boychik | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| zinky | 5 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (158)
quicklywhiskeyluckilypricklywrinklyskylineyakkinghickoryricketykilljoypanickyfinickyshakilythicklybrisklycolickykitschysickbaysoymilkkatydidskydivepinkeyetricksycrinklyshriekytwinklyslicklywackilykyanitelinkboymurkilydisyokekylikesivylikealkylic
...View all with 7 letters...
Phrases (10)
dry kilndry milkkey limekey ringsick paystick byinky capwhisk bykuan yinsky diveWords (180)
unlikelyskylightmckinleytrickeryjoystickladylikejokinglysukiyakiunkindlyvalkyriewickedlyteriyakiskydivernijinskysikorskygimmickyknightlycytokinebiweeklysneakilygarlickykilobytekyphosisrakishlyspookilykolinskycheekilykeffiyehwhiskerykyphotictrickilyskimpilyfrolickyknottilypluckily
...View all with 8 letters...
Phrases (18)
minor keyeye blinkmilk wheyinbus keyyak's milkstink flykey fruitlucky diptonic keypink lady
...View all with 8 letters...
Words (184)
yorkshirepiggybackknowinglyreykjavikskydivingbuttinskymockinglyunluckilykimberleykeynesianmonkeyingwyszynskiyardstickjockeyingdoohickeykandinskyskilfullyhaymakingjellylikeskywriterankylosisgimmickryhyperlinkbrickyardmawkishlypuppylikeknavishlybumpkinlysylphlikeberrylikepuckishlyyuckinessquakinglyfairylikeperikarya
...View all with 9 letters...
Phrases (26)
like crazygin rickeysay hey kidcity blockmilk yieldmike tysonstrike payrelay linkdirty jokeabukir bay
...View all with 9 letters...
Words (153)
mistakenlybricklayershockinglystravinskyskillfullyfreakishlystrikinglyrockabillyskywritingeukaryoticpernicketylawyerlikespankinglylikabilityunladylikepickaninnyalkalinitydyskinesiatrotskyiteplaymakingtrickishlyprankishlykanamycinsdyskineticpiggybacksskylightedsneakinglymythmakingthinkinglybrickyardskerygmaticyardsticksalkylatingskittishlyungimmicky
...View all with 10 letters...
Phrases (48)
mt. mckinleymaxim gorkykuwait cityisle of skyegreek deitypaying backpink familylady killerpyknic typefloppy disk
...View all with 10 letters...
Words (118)
unknowinglytchaikovskybaryshnikovyellowknifepersnicketyhypokalemiamonkeyshinehypokalemickinesiologykeyboardistbricklayingsickeninglymoneymakingmerrymakingkinyarwandaskepticallyworkabilitytiddlywinksyastrzemskiunthinkablytalkativelyprovokinglyhyperlinkedkeystrokingflyspeckingpiggybackedbankabilitybricklayerskaryogamiesbookbinderyalkylationschucklinglychimneylikecytokineseskeyboarding
...View all with 11 letters...
Phrases (55)
louis leakeylike royaltybilly the kidpolicy makeralkyl halideclosely knitdirty trickstightly knitcelery stickmaksim gorky
...View all with 11 letters...
Words (82)
unmistakablystanislavskyhyperkalemiahyperkineticunthinkinglyholidaymakermoneymakingshyperkineseshyperkinesiahyperlinkingunskillfullyunblinkinglymonkeyshinesflickeringlymerrymakingsbricklayingskaryokinetickeyboardistsleukocytosishyperkinesiscockneyfyingpaddywackingstringybarksdaydreamlikepiggybackingkymographieskremlinologyhydrokineticdrinkabilityskyrocketinghypokalemiastracklayingsbodycheckingkaryokineseskaryological
...View all with 12 letters...
Phrases (62)
body stockinglickety splithockey clinicshaking palsyrisky venturealkyl radicalginkgo familyboris spasskybrown hickoryblink of an eye
...View all with 12 letters...
Words (43)
painstakinglymarketabilitypsychokineticpsychokinesisholidaymakersrekeyboardingunworkabilityhyperkinesiashydrocrackingtiddledywinkspsychokinesesunknowabilitykindheartedlykinematicallyunshrinkinglythankworthilybradykinesiasstickybeakingblackberryingfairnytickleskitty-corneredclickety-clackclickety-clickjawbreakinglyginkgophytinahydrokineticsremarkabilitydostoyevskianknickknackeryunmistakeablyankyloglossiahydraulickingpoikilothermykenyapithecussketchability
...View all with 13 letters...
Phrases (60)
el iskandriyahbitter hickorymount mckinleycocktail partythree kings' daynylon stockingdiospyros kakirichard leakeyanxiety attackbanking system
...View all with 13 letters...
Words (22)
unthinkabilityhyperkeratotickaryotypicallybreathtakinglyhyperkeratosisearthshakinglyheterokaryosisheterokaryoticmegakaryocytichydrocrackingshydrokineticalleukocytosisesblackberry-lilyblackberryingsvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesrimsky-korsakovdiphenylketonekinematographybrachypinakoidPhrases (83)
dimethyl ketoneveliky novgorodigor stravinskycapital of kenyablended whiskeyemily dickinsonturkey stuffingkyrgyz republicdynamic speakerrudyard kipling
...View all with 14 letters...
Words (19)
lackadaisicallyheartbreakinglykinestheticallyankylostomiasesankylostomiasisphenylketonuriccholecystokinintelekineticallyphytoplanktonicphenylketonuriapyknodysostosisknowledgabilitycockneyficationkenogeneticallypoverty-strickenlymphoblast-likehuckleberryingsdiphenylketonesbrachypinakoidsPhrases (69)
turkey drumstickbuckthorn familycapital of turkeydocking facilityalfred korzybskisecurity blanketandrei tarkovskywilliam mckinleymarketable yieldwilliam shockley
...View all with 15 letters...
Words (8)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosisescholecystokininsknowledgeabilityPhrases (53)
strictly speakingalan lloyd hodgkinfyodor dostoevskicapital of new yorkfriendly takeoverfrank lloyd wrightfamily gekkonidaeelwyn brooks whiteassyrian akkadianpresident kennedy
...View all with 16 letters...
Phrases (15)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykosubdivision ginkgophytinaaleksey maximovich peshkovfrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneylucy in the sky with diamonds
...View all with 24 letters...
Phrases (18)
igor fyodorovich stravinskyfrancis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskymelville louis kossuth deweypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkov
...View all with 25 letters...
Phrases (12)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventory
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
