Words Containing: I,K,L,S,Y
(In Any Order)
There are 241 words,
274 phrases and
0 abbr's with
I,K,L,S,Y in.
Best Scoring Words With: I,K,L,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
kylikes | 7 | 18 | nounn | |||||
noun • An Ancient Greek drinking cup with a stem, two handles, and a broad, shallow body | ||||||||
skylike | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
shakily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in an insecurely shaky manner • in a manner characterized by trembling or shaking | ||||||||
huskily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in a hoarse or husky voice | ||||||||
briskly | 7 | 16 | adverbadv | |||||
adverb • in a brisk manner | ||||||||
soymilk | 7 | 16 | nounn | |||||
noun • a milk substitute containing soybean flour and water; used in some infant formulas and in making tofu | ||||||||
slickly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • with superficial plausibility | ||||||||
peskily | 7 | 16 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
spikily | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
beyliks | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
silkyWords (32)
skylightsneakilyrakishlyspookilykolinskyskimpilyslinkilyswankilykilljoysskylinesfriskilylinkboyssmirkilystockilysnarkilyfolksilykielbasystalkilyskysailskissablyyokelishyolkiestladykinssickerlystickilysoymilkssicklilysparkilyspunkilykeylineskyllosisilkadaysPhrases (6)
yak's milkstink flysilky elmsilky oaksoya milksky pilotWords (44)
skilfullyankylosismawkishlyknavishlysylphlikepuckishlysyruplikeirksomelywalkyrieshawkishlygawkishlyweakishlysketchilystreakilyplastickykilobytesmonkishlyflunkyismskylightsyeastlikekailyardskryoliteskryolithseyeblinkspalsylikevalkyriessickishlybookishlysqueakilysicklyingsatyrlikepeckishlymilksoppyscreakilysoakingly
...View all with 9 letters...
Phrases (1)
sky burialWords (51)
mistakenlyshockinglyskillfullyfreakishlystrikinglyspankinglytrickishlyprankishlyskylightedsneakinglyskittishlyhyperlinksshylockingticklishlykilocyclessemiweeklyskylarkingflunkyismsankylosingkindlesslystinkinglythylakoidsbillycockslackadaisyskulkinglyscythelikesneakishlybillystickflystrikesskimminglyblockishlyskimpinglyblackishlyskinflintyspeakingly
...View all with 10 letters...
Phrases (8)
isle of skyefloppy diskplay tricksalkyd resinroy wilkinsmalt whiskysleepy dickprickly ashWords (29)
kinesiologysickeninglyskepticallytiddlywinksflyspeckingbricklayersalkylationsplaymakingslymphokinesbrainsicklylickerishlykaryologieskittenishlychelyabinskunskilfullyflunkeyismsskylarkingsjaywalkingsshriekinglymistakeablythelytokiesshrinkinglykaryologistsqueakinglybialystokersparklinglysilky-hairedsilky-leafedsilky-leavedPhrases (11)
louis leakeyclosely knitcelery stickloosely knitmalt whiskeysydney silkycrystal mikesilky cornelcity slickersilky willow
...View all with 11 letters...
Words (26)
unmistakablystanislavskyunskillfullybricklayingsleukocytosishypokalemiastracklayingsgallygaskinspinnywinklesblackish-grayblackish-greycockyleekiesgreyish-blacktiddleywinkspennywinklesladylikenessfernyticklesgrayish-blackpoikilocyteskaryologistskaryoplasmiclocksmitherytiggywinklesquicksilveryshockabilitystickabilityPhrases (12)
lickety splitshaking palsyalfred kinseyturk's cap-lilyslippery dickrayleigh disksalt lake cityskittle alleyblack salsifysilky dogwood
...View all with 12 letters...
Words (8)
lackadaisicallykinestheticallyankylostomiasesankylostomiasischolecystokininlymphoblast-likehuckleberryingsdiphenylketonesPhrases (15)
alfred korzybskisecurity blanketwilliam shockleygenus myxinikelahydraulic brakessprinkler systemstinking gladwynlashkar-e-tayyibanickel-base alloydisability check
...View all with 15 letters...
Words (5)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsPhrases (17)
strictly speakingelwyn brooks whiterodya raskolnikovwassily kandinskiwassily kandinskyproperly speakingbenjamin kubelskywhite honeysuckleshellbark hickoryhypovolemic shock
...View all with 16 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay