Words Containing: I,G,Y,N,I,E,S
(In Any Order)
There are 290 words,
464 phrases and
0 abbr's with
I,G,Y,N,I,E,S in.
Best Scoring Words With: I,G,Y,N,I,E,S
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
specifying | 10 | 21 | verb, noun, adjectivev, n, adj | |||||
verb • specify as a condition or requirement in a contract or agreement; make an express demand or provision in an agreement • decide upon or fix definitely • determine the essential quality of • be specific about • define clearly • design or destine • select something or someone for a specific purpose | ||||||||
versifying | 10 | 20 | verb, noun, adjectivev, n, adj | |||||
verb • compose verses or put into verse | ||||||||
presignify | 10 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
hygienics | 9 | 18 | nounn | |||||
noun • the science concerned with the prevention of illness and maintenance of health | ||||||||
densifying | 10 | 18 | verb, adjectivev, adj | |||||
verb • To make dense. • To become dense. | ||||||||
testifying | 10 | 17 | verb, noun, adjectivev, n, adj | |||||
verb • give testimony in a court of law • provide evidence for | ||||||||
disobeying | 10 | 17 | verb, adjectivev, adj | |||||
verb • refuse to go along with; refuse to follow; be disobedient | ||||||||
semidrying | 10 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
shinneying | 10 | 17 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
hygienists | 10 | 17 | nounn | |||||
noun • a medical specialist in hygiene | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (29)
kinesiologysickeninglysynergisticingeniouslysystemizingemulsifyingstellifyingphilogyniesresinifyingesterifyinggreylistingdesigninglybesieginglyoxygenisinggreyish-pinksynergisingforesignifysynergizingshriekinglysystemisingswingeinglysynoecisingsynoecizingshiveringlylysigeneticsimperinglyresistinglyperishinglyhyphenisingPhrases (1)
stinking yewWords (65)
increasinglyintensifyingdespairinglydiversifyingsynthesizingpersonifyinghesitatinglymisleadinglysyncretisingblisteringlysyncretizingdemystifyingwhisperinglydisembodyingretestifyingindigenouslydesertifyingdiscerninglydemulsifyingsemideifyingspeechifyingrejustifyingsymmetrizingrespecifyingdisemployingredisplayingmisemployingtypewritingssolemnifyinglysogenicitylysogenisinglysogenizinglaryngitisespolymerisingpersistingly
...View all with 12 letters...
Phrases (6)
syringa emodiicing syringeenglish daisytissue typingwriting stylefiling systemWords (55)
interestinglydistressinglyquestioninglyphysostigminehypothesisingproselytizinghypothesizingresolidifyingundisguisedlyreclassifyingserpiginouslydeclassifyingsystematisingsystematizingsaprogenicitydisquietinglypresignifyingprespecifyingproselytisingvertiginouslydigressionaryinvestigatoryphysiognomiessyringomyeliasyringomyelicetymologisingpharyngitidesconveyorisinggeodynamicistmoneyspinninghypothetisingstickybeakingdecrassifyingunreligiouslymyringotomies
...View all with 13 letters...
Phrases (8)
writing systemspinning jennyhemizygos veingenus boykiniasaint gregory igary weinsteingeomys pinetispricing systemWords (40)
cytogeneticistunhesitatinglydisingenuouslyspellbindinglyresynthesizingintransigentlymisidentifyingsyringomyeliasphysostigminespyrogenicitieslysogenicitieslysogenizationnitroglycerinsseronegativitythymectomisingdispropertyingyieldingnessesdepolymerisinggeodynamicistsserpentininglypresanctifyingsingle-mindedlylymphangitideslymphangitisesenterprisinglyunyieldingnesssphingomyelinshistogenicallyforesignifyingunappetisinglyhypermastiginagenotypicitiesdisbelievinglyembellishinglylysogenisation
...View all with 14 letters...
Phrases (17)
henry kissingerlight intensitygesneria familysyringa persicaignition systemhemizygous veingenus cymbidiumgenus phyllitisvirginia oysterkenyan shilling
...View all with 14 letters...
Words (45)
synergisticallyoversimplifyingrecrystallizingunquestioninglysidesplittinglycommiseratinglydisenchantinglydishearteninglyoverclassifyingnitroglycerineshypervigilanceshyposensitizingresystematizingcytogeneticistsdisconcertinglylysogenizationsintransigeantlybourgeoisifyingindigestibilitythirtysomethingrecrystallisinghyperimmunisingdemythologisingdehydrogenisingrecognisabilitymetaphysicisingneologisticallymetaphysicizinghyperpolarisingempyreumatisinguninterestinglydesynchronizingthirty-somethingenhypostatisingenhypostatizing
...View all with 15 letters...
Phrases (28)
doris may lessingmagnetic pyritespilgrim's journeychange intensitygenus myxinikelareceiving systemhypogastric veingenus lysichitongenus lysichitumgenus lysimachia
...View all with 15 letters...
Words (10)
inextinguishablyhypersensitizinghyperstimulatinglyginopteridalesstrongyloidiaseslymphangiectasialymphangiectasisneurophysiologicinterstratifyingevangelisticallyPhrases (25)
strictly speakingchristian huygenscynoscion regalisguilty consciencepyroligneous acidpolygenic diseaseinstrument flyingorbignya spesiosagenus sciadopityssingle-leaf pinyon
...View all with 16 letters...
Words (6)
neurophysiologiststrongyloidosisessamoyedic-speakingneurophysiologiesphotosynthesizingdemythologisationPhrases (36)
interstate highwayyeniseian languagereligious ceremonyadvertising agencysoldier grainy clubchristiaan huygenshypodermic syringegenus lyginopterispolygenic disorderfamily leguminosae
...View all with 17 letters...
Words (10)
hypophysectomizinglymphangiographiesmagnetostrictivelygranulocytopoiesisneurophysiologistsdemythologizationssedimentologicallydihydroergotaminesneurophysiologicalhyperpigmentationsPhrases (40)
navigational systemantipsychotic agentwedding anniversarygenus citharichthyspluvianus aegyptiusgeophysical sciencepriority processingdissociation energyphotogenic epilepsydaylight-saving time
...View all with 18 letters...
Words (3)
extralinguisticallycytopathogenicitiesphytohemagglutininsPhrases (42)
building supply housejohn millington syngefamily cynoglossidaesalicylate poisoninguniversity of chicagounix operating systemgossypium peruvianumsurveying instrumentunited nations agencydiversionary landing
...View all with 19 letters...
Words (2)
magnetofluiddynamicsneurophysiologicallyPhrases (30)
classifying adjectiveluscinia megarhynchosbasidiomycetous fungisaturday night specialwilliam jennings bryansecurity intelligencesir henry rider haggardsedative-hypnotic druggregory goodwin pincusdivision euglenophyta
...View all with 20 letters...
Words (1)
laryngotracheobronchitisPhrases (24)
carnegie mellon universityargyroxiphium sandwicensezollinger-ellison syndromesir terence mervyn rattigandistinguished flying crosstechnology administrationposterior meningeal arterydivision gymnospermophytaaccessory hemiazygous veinprimary colour for pigments
...View all with 24 letters...
Phrases (16)
diamond wedding anniversaryfrancis scott key fitzgeraldedmund john millington syngereligious society of friendssir arthur stanley eddingtonreticular activating systemarab revolutionary brigadescygnus columbianus bewickiisuperorder acanthopterygiithyroid-stimulating hormone
...View all with 25 letters...
Phrases (14)
hunting and gathering societyassyrian neo-aramaic languagenewton's theory of gravitationbenign prostatic hyperplasiamyrtillocactus geometrizanscalifornia single-leaf pinyonforce-feed lubricating systemgeneralized anxiety disorderbetty naomi goldstein friedanthyrotropin-releasing factor
...View all with 26 letters...
Phrases (15)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinnuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoinformation processing systemtopical prostaglandin eyedrop
...View all with 27 letters...
Phrases (13)
ephippiorhynchus senegalensismicrosoft disk operating systemrevolutionary communist leaguesingle nucleotide polymorphismimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonemilitary intelligence section 5military intelligence section 6melanocyte-stimulating hormone
...View all with 28 letters...
Phrases (9)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory druglymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisbosnian-herzegovinian monetary unitcystic fibrosis transport regulatorPhrases (1)
enzyme-linked-immunosorbent serologic assay