Words Containing: I,G,N,L,Y
(In Any Order)
There are 2,506 words,
1,279 phrases and
0 abbr's with
I,G,N,L,Y in.
Best Scoring Words With: I,G,N,L,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
lazying | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
jingly | 6 | 17 | adverb, adjectiveadv, adj | |||||
adjective satellite • having a series of high-pitched ringing sounds like many small bells | ||||||||
vyingly | 7 | 17 | ||||||
Valid word for Scrabble US
| ||||||||
cycling | 7 | 15 | verb, nounv, n | |||||
noun • the sport of traveling on a bicycle or motorcycle | ||||||||
cymling | 7 | 15 | nounn | |||||
noun • squash plant having flattened round fruit with a scalloped edge; usually greenish white | ||||||||
nightly | 7 | 14 | adverb, adjectiveadv, adj | |||||
adverb • at the end of each day adjective satellite • happening every night | ||||||||
kingly | 6 | 14 | adjectiveadj | |||||
adjective satellite • having the rank of or resembling or befitting a king | ||||||||
levying | 7 | 14 | verb, nounv, n | |||||
noun • a charge imposed and collected • the act of drafting into military service verb • impose and collect • cause to assemble or enlist in military | ||||||||
shingly | 7 | 14 | adjectiveadj | |||||
adjective satellite • abounding in small stones | ||||||||
lyingly | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (136)
applyingbullyingimplyinglovinglylobbyingyodelingrallyingyieldinglynchingjokinglyoutlyingdallyingrelayingbelayingallayinggingerlyglyceringraylingtallyinglayeringungainlybenignlysullyingbellyingachinglyhungrilyboringlyknightlyravinglygullyingwooinglymovinglytangiblyyearlingglorying
...View all with 8 letters...
Phrases (1)
laying onWords (319)
amazinglywillinglygenuinelyseeminglyrecyclinganalyzingsmilinglysupplyingknowinglylongevityplaythinganalysingunsightlymockinglyglycerinevaryinglyglaringlypygmaliongentilitycunninglysparinglywinninglylonginglygainfullycomplyingbicyclinghaltinglyparleyingroaringlyamusinglyyodellingnumbinglyfeelinglypolygenicvainglory
...View all with 9 letters...
Phrases (8)
egg layingnot guiltyyoung girlflying foxdrying oilflying catflying jibbunny girlWords (457)
originallyunderlyingqualifyingnegativelydiligentlyshockinglyneighborlyscathinglystunninglyunyieldingcharminglyclarifyingdiagonallyswimminglysingularlyfalsifyingannoyinglystrikinglylaryngitisalarminglyblindinglyparalysingmenacinglygrudginglyamplifyingmarginallymalignancysmashinglygrindinglyhauntinglyglorifyingoverlayingtouchinglycatalyzinglaughingly
...View all with 10 letters...
Phrases (22)
dry wallinghanging flyglycine maxflying boatgrainy clubtyping poolyi languageenglish ivygenus layiaenglish yew
...View all with 10 letters...
Words (407)
geneticallyaccordinglyexceedinglyunwittinglyunknowinglyoriginalityterminologysingularitymultiplyingunwillinglycriminologyorganicallysymbolizinglingonberryscientologyyugoslavianappallinglyplaywritingangelicallystultifyingsimplifyingornithologylingeringlymalignantlythrillinglyindignantlydeservinglyneighbourlyunceasinglyangioplastyclassifyingunfailinglycognitivelykinesiologysolidifying
...View all with 11 letters...
Phrases (40)
laying claimlaying wastebulb syringesingle entryplaying areadry cleaningrunning playtightly knitholding yardlegal injury
...View all with 11 letters...
Words (346)
increasinglysurprisinglygynecologiststorytellingconvincinglydisgustinglyelectrifyingrefreshinglybodybuildingunimaginablydisturbinglycongenialityterrifyinglycompellinglybelligerencyphylogeneticungraciouslybegrudginglystaggeringlyenchantinglyincorrigiblymagneticallydepressinglydespairinglyresoundinglyhygienicallyintelligiblylollygaggingunwaveringlygratifyinglyexemplifyingbullyragginglallygagginghydroplaningcontagiously
...View all with 12 letters...
Phrases (60)
genus glycineshaking palsypolicy changefolding moneyginkgo familylong-fin tunnyflying colorsgenus mytilusmanila magueyrecycling bin
...View all with 12 letters...
Words (281)
significantlyinterestinglygynaecologistintelligentlyfrighteninglymagnificentlyastonishinglynitroglycerineverlastinglypainstakinglyoveranalyzingbiotechnologyinfuriatinglydistressinglyenergeticallygynecologicalunflinchinglyunremittinglydisparaginglyhumiliatinglyendocrinologyunrelentinglymeaninglesslyquestioninglycrystallizingignominiouslyfascinatinglyunoriginalityoverbearinglyunforgivinglynostalgicallydillydallyingmyoglobinuriapalynologicalnightmarishly
...View all with 13 letters...
Phrases (69)
vaginal arterydwindling awaysalivary glandgenus dactylislillie langtrycatalog buyinghenry fieldingnylon stockingliterary genrecrystal gazing
...View all with 13 letters...
Words (184)
overwhelminglynitroglycerineexcruciatinglygynaecologicalembarrassinglylinguisticallyunintelligiblyunconvincinglyentertaininglydiagnosticallyunsuspectinglyanesthesiologydisapprovinglyunhesitatinglyethnologicallyoverpoweringlymagniloquentlyimpregnabilitydisingenuouslydepolymerizingthyroglobulinsgenerationallyinfrangibilitydiscouraginglyhypoallergenicinvigoratinglygenealogicallyegocentricallyintimidatinglyacceleratinglyspellbindinglyunappetizinglymisclassifyingantiregulatoryglycogenolysis
...View all with 14 letters...
Phrases (98)
pituitary glandhigh technologyveliky novgorodtightly fittingrudyard kiplingmagnolia familymilitary ratinglight intensitymalpighian bodyphysical change
...View all with 14 letters...
Words (153)
technologicallyanaesthesiologychronologicallysynergisticallyoversimplifyingcondescendinglydisappointinglyneurophysiologyrecrystallizinggastronomicallyunquestioninglycorrespondinglyheartbreakinglyinterrogativelyaccommodatinglyagranulocytosisunchangeabilitysidesplittinglycommiseratinglypsychoanalyzingunintelligentlydisenchantinglynonbelligerencydishearteninglynonbiologicallyintelligibilitydistinguishablyuncopyrightableoverclassifyingnitroglycerineshypervigilancesuncomplaininglyethnomusicologydisconcertinglyphosphorylating
...View all with 15 letters...
Phrases (115)
syringa vulgarisbenefit of clergyasamiya languagemail-order buyinggenus sylvilagusgenus bombycilladoris may lessingegg-laying mammalmarginal utilityegyptian capital
...View all with 15 letters...
Words (57)
hyperintelligentphylogeneticallyuncompromisinglyunapologeticallyinextinguishablypornographicallyparamagneticallytrinitroglycerinotolaryngologisthyperstimulatinghyperventilatingnonpsychologicalhemoglobinopathycriminologicallyorganizationallyiconographicallylyginopteridalesstenographicallyflabbergastinglynonsignificantlyindefatigabilitycytotechnologiescytotechnologiststrongyloidiasesstrongyloidiasislymphangiectasialymphangiectasislymphangiographyconsanguineouslyoligodendrocytesimmunohematologygeneralizabilityimmunoregulatoryorganolepticallyphonogrammically
...View all with 16 letters...
Phrases (116)
italian greyhoundstrictly speakingcapital of hungarycommercial agencyalan lloyd hodgkindwight lyman moodyisland of guernseypharyngeal tonsilcynoscion regalisgrand mal epilepsy
...View all with 16 letters...
Words (31)
anthropologicallyneurophysiologistpsycholinguisticsunexchangeabilityferrimagneticallymorphogeneticallymicropaleontologylymphangiographicconfigurationallycytotechnologistsimmunogeneticallyelectronegativitystrongyloidosisesoceanographicallyglycosaminoglycantrigonometricallyhyperintelligenceunintelligibilityotolaryngologicalneurophysiologiesotolaryngologistsdisadvantageouslyneuropsychologiesneuropsychologistdephosphorylatinguncomprehendinglydemythologisationdemythologizationhaemoglobinopathyindistinguishablypaleomagneticallyPhrases (120)
hypoglycemic agentpearly everlastingmalaysian languagecylindrical liningrepublic of hungarytypha angustifoliayeniseian languagefamily engraulidaegenus dactylorhizaivy-leaved geranium
...View all with 17 letters...
Words (23)
interchangeabilityneuropsychologicallaryngopharyngitislymphangiographiesdistinguishabilitymagnetostrictivelyphenomenologicallygeochronologicallyneuroendocrinologyglycosaminoglycansgranulocytopoiesesgranulocytopoiesisneurophysiologistsultracentrifugallyneuropsychologistsdemythologizationspropagandisticallyrhinolaryngologistroentgenologicallysedimentologicallyindiscriminatinglyphytohemagglutininneurophysiologicalPhrases (114)
revolutionary groupfreudian psychologynavigational systemfulminating mercuryfamily magnoliaceaegene delivery vectorparliamentary agentalbert szent-gyorgyimilitary governmentglyceryl trinitrate
...View all with 18 letters...
Words (12)
cinematographicallyextralinguisticallyotorhinolaryngologyparthenogeneticallycrosslinguisticallydehydrochlorinatingelectromagneticallyhysterosalpingogramcross-linguisticallyelectroretinographyphytohemagglutininssociolinguisticallyPhrases (94)
building supply housejohn millington syngefamily cynoglossidaealpine type of glaciergiles lytton stracheycapital of kyrgyzstansalicylate poisoningfamily zingiberaceaegerard manley hopkinssantiago ramon y cajal
...View all with 19 letters...
Words (8)
polyphiloprogenitiveindistinguishabilitylymphogranulomatosismagnetofluiddynamicsoophorosalpingectomyneurophysiologicallyroentgenographicallysyncategorematicallyPhrases (76)
oryctolagus cuniculusbyelorussian languagemagnetic bubble memoryclassifying adjectiveluscinia megarhynchosmilitary intelligencefamily gleicheniaceaeaustralian bonytonguephylogenetic relationpass with flying colors
...View all with 20 letters...
Words (6)
hypogammaglobulinemiaotorhinolaryngologistotorhinolaryngologiesdendrochronologicallyantiferromagneticallyclinicopathologicallyPhrases (64)
bulgarian monetary unitcynoglossum officinaleginglymostoma cirratumspeech intelligibilityhans holbein the youngercongenital abnormalitymongolian monetary unitsyngnathus hildebrandimichel eyquem montaignejohn fitzgerald kennedy
...View all with 21 letters...
Words (2)
otorhinolaryngologicalotorhinolaryngologistsPhrases (66)
high-density lipoproteinguatemalan monetary unitamygdalus communis amarahenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucasedward kennedy ellingtonbahasa malaysia languagesir george otto trevelyan
...View all with 22 letters...
Words (1)
laryngotracheobronchitisPhrases (31)
carnegie mellon universitymary wollstonecraft godwinunidentified flying objectzollinger-ellison syndromedistinguished flying crosstechnology administrationfederal republic of germanypaul johann ludwig von heyseposterior meningeal arteryconstitutional psychology
...View all with 24 letters...
Phrases (20)
francis scott key fitzgeraldcentral intelligence agencyedmund john millington syngereligious society of friendssir arthur stanley eddingtonreticular activating systemarab revolutionary brigadescygnus columbianus bewickiimargaret munnerlyn mitchellmercury-in-glass thermometer
...View all with 25 letters...
Phrases (18)
brassica oleracea gongylodessubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languageentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizansgilles de la tourette syndromecalifornia single-leaf pinyonforce-feed lubricating system
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (17)
george percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensistopical prostaglandin eyedrop
...View all with 27 letters...
Phrases (14)
revolutionary people's struggleephippiorhynchus senegalensisrevolutionary communist leaguecygnus columbianus columbianussingle nucleotide polymorphismimperial japanese morning gloryhypothalamic releasing hormonecentral intelligence machinerymilitary intelligence section 5military intelligence section 6
...View all with 28 letters...
Phrases (10)
great smoky mountains national parkdigital communications technologyrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planninghuygens' principle of superpositionnorth atlantic treaty organizationmary godwin wollstonecraft shelleyPhrases (9)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencyunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay