Words Containing: I,G,E,N,E
(In Any Order)
There are 7,010 words,
5,427 phrases and
0 abbr's with
I,G,E,N,E in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
feezing | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
heezing | 7 | 20 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
jeeping | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
agenize | 7 | 17 | verbv | |||||
verb • age or bleach flour with Agene (nitrogen trichloride) | ||||||||
keeking | 7 | 16 | ||||||
verb • To peek; peep. | ||||||||
jeering | 7 | 15 | verb, adjectivev, adj | |||||
noun • showing your contempt by derision adjective satellite • abusing vocally; expressing contempt or ridicule | ||||||||
exigent | 7 | 15 | adjectiveadj | |||||
adjective satellite • demanding attention • requiring precise accuracy | ||||||||
keeping | 7 | 14 | verb, nounv, n | |||||
noun • conformity or harmony • the responsibility of a guardian or keeper • the act of retaining something | ||||||||
hygiene | 7 | 14 | nounn | |||||
noun • a condition promoting sanitary practices • the science concerned with the prevention of illness and maintenance of health | ||||||||
jeeing | 6 | 14 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (128)
feelingeveningmeetingkeepingfeedingseekinggenuinegeneticweepingfleeinghygienegenesislineagepeelingfreeinggentilegenericseemingteemingjeeringeugeniaregimenseepingreekingfeignedingenueleeringveeringintegerbeguineexigenttreeingkeeningpeevingneglige
...View all with 7 letters...
Phrases (3)
e regionbe givenhedge inWords (348)
sleepingfeelingscheeringbleedingnegativedesignedfreezingengineerenteringdesignereighteenbreedingspeedingregimentsteeringgreetingresignedsweepingeveningslingeriegenocidecreepingbeginneremerginggeniusesagreeinggeneticsfleetingwheezingkneelingfingeredsneezingcarnegieeugenicsgermaine
...View all with 8 letters...
Phrases (8)
mine cagebee stinggene chipin leaguetee hingeming treegive ventget a lineWords (717)
recognizeexpectingbelievingrecognisenegotiatedefendingreceivingforeignerrepeatingreferringreleasingrevealingscreeningsovereigndeceivingsqueezinggenuinelyseeminglyenergeticenlightenpesteringconciergeguinevereespionagesteinbergdetectingexecutingrefuelingtangerinedeservinggreenwichweakeningangeliquerenderingintegrate
...View all with 9 letters...
Phrases (38)
line judgeseeing redview angleguinea henpeace signandre gidegiven namegenus eirasingle bedesox niger
...View all with 9 letters...
Words (965)
everythinggenerationfrightenedpretendingrecognizedscreechingvegetariandevelopingdepressingrehearsingrefreshingrecoveringrecognisedgenerosityallegianceingredientdesignateddelegationexercisingrespectingproceedingvegetationnegotiabledescendingintegratedgeneratingreflectingnegligencesentencingindulgencepreservingsucceedingcentigradenegativelyheisenberg
...View all with 10 letters...
Phrases (85)
coffee ringgentle windenergy unitgenus abiesmusic genresui generiscasein gluegenus cimexgenus felisfinger wave
...View all with 10 letters...
Words (1180)
interestingintelligentthreateningforgivenessinvestigatecelebratingmeaninglessengineeringrememberinginterferingeverlastinginterrogategeneticallyproceedingsenlightenedsightseeingsovereigntypenetratingdeterminingexceedinglysegregationgingerbreadmesmerizingsafekeepingbelligerentrenegotiateevangelicaloverbearingoverheatinggendarmerievinaigrettebookkeepingunrelentingimpregnablegreasepaint
...View all with 11 letters...
Phrases (185)
genus myxinegenus bletiameat grinderin agreementgenus perdixsingle entrygenus pernisgenus viperasteam enginebluish green
...View all with 11 letters...
Words (1140)
intelligencekindergartenentertainingoverwhelmingexperiencinginvestigatedexaggeratingcheerleadingmichelangelointerrogatedextinguishersleepwalkingdisagreementextinguishedacceleratinghousekeepingexaggerationrecognizableenlighteningregenerationinterpretingmagnificenceredecoratingdisintegrateoverpoweringracketeeringdegenerativeinfringemententerprisingdegenerationwittgensteinwestinghouseelectrifyingunregisteredguaranteeing
...View all with 12 letters...
Phrases (361)
alec guinnessgrain cleanerjan tinbergengenus glycinesponge filterhead coveringwetting agentmeeting placelittle fingergenus encelia
...View all with 12 letters...
Words (923)
enlightenmentrighteousnessinvestigativeeavesdroppingcondescendingheartbreakinginterestinglystrengtheningdeterioratinguninterestingdisintegratedrefrigerationintelligentlyundercarriageargumentativebutterfingersexterminatingeverlastinglyexteriorizingnecessitatingunintelligentexsanguinatedcrossbreedingcounterweighttelemarketingreintegrationindefatigableenergeticallygeneralissimoreverberatinghousecleaningnonnegotiableinterrogativedeoxygenationdecerebrating
...View all with 13 letters...
Phrases (454)
might-have-beenbelgian endivebreathing timegenus cricetusline engravingsummit meetingfellow feelingmachine gunnergenus anthemisstephen girard
...View all with 13 letters...
Words (688)
unintelligibleoverwhelminglyunrecognizableaggressivenesscytogeneticistelectroplatingmountaineeringintelligentsiadisembowellingnitroglycerinereconnoiteringdepigmentationgeneralizationweightlessnessunrefrigeratedunderachievingnonthreateningfortunetellingunrecognisablediscouragementgeneralisationoverestimatingaggrandizementtelangiectasiareexperiencingentertaininglyunenlighteningtergiversationmeaningfulnessfarsightednessneighborlinesskindergartenerantigovernmentelectioneeringgregariousness
...View all with 14 letters...
Phrases (539)
negeri sembilanpier luigi nervigarageman's liengelatin dessertkissing diseasebreathing placenoachian delugebreathing spacebreathing spellgenus elettaria
...View all with 14 letters...
Words (495)
electromagneticcinematographerunderprivilegedanaesthesiologyinterchangeableintercollegiatespermatogenesisparthenogenesisinconveniencingdifferentiatingmeaninglessnesscounterweightedcondescendinglyforesightednessgastroenteritisgentlemanlinessunrighteousnessreinvestigatingrematerializinglightheadednessdematerializingnearsightednessinterrogatoriesheartbreakinglyuncomprehendingunprepossessinginterrogativelytightfistednessprestigiousnessprogressivenessnonintersectingdisgracefulnessimaginativenesspreregistrationmicromanagement
...View all with 15 letters...
Phrases (544)
measuring devicefalco peregrinusbenefit of clergyhigh renaissancegenus potentillasuperior generalbelgian shepherdbengali languagegenus priodontesstrange particle
...View all with 15 letters...
Words (177)
anesthesiologistelectromagnetismshortsightednesscountersignaturehyperintelligentcounterespionagephylogeneticallyelectromagneticsteleconferencinglightheartednessdisentanglementshypersensitizingantitechnologiesingloriousnessesthermoregulatingunneighborlinessingressivenessesthermoregulationhyperventilatingcounterweightingroentgenographicfarsightednessesweatherstrippingfeatherstitchingjungermanniaceaerechoreographingsprightfulnesseslyginopteridalesfigurativenessesinextinguishablecurmudgeonlinessflagitiousnessesimaginablenesseslugubriousnessesperiodontologies
...View all with 16 letters...
Phrases (546)
multiengine planegenus angiopterisdefinite integralcovering materialgenus periplanetagenus proboscideaorder of magnitudetender loving caregenus procellariaget under one's skin
...View all with 16 letters...
Words (108)
counterinsurgencyintergovernmentalintellectualizingcountersignaturessuperintelligenceunexchangeabilitycounterstrategiescounterstrategistunmitigatednessescountersuggestionthermoregulationsdisgracefulnessesicelandic-speakingunrighteousnessestightfistednessesferrimagneticallymorphogeneticallyoutward-developingignominiousnessesrecognizabilitieslongsightednessesantireligiousnessimaginativenessesreconceptualizingcerebromeningitisindefatigablenessmultigenerationaltransgenerationalforesightednessesrecontextualizingimmunogeneticallyvideoconferencingelectronegativityimmunogeneticistsmagnanimousnesses
...View all with 17 letters...
Phrases (492)
object recognitioncompetence hearinggenus globicephalamespilus germanicanikolaas tinbergenhypoglycemic agentinterstate highwaypearly everlastingmiguel de cervantesorder oedogoniales
...View all with 17 letters...
Words (61)
gastroenterologistinterchangeabilityinexpugnablenessesunintelligiblenesscounterstrategistscountersuggestionsknowledgeabilitiesdisingenuousnessessphygmomanometrieslightheartednessescurmudgeonlinessesvaingloriousnesseslacto-vegetarianismvideoconferencingsimmunohematologiesmagnetoresistancesintelligiblenessesmagnetostrictivelyphenomenologicallygastroenterologiesgedankenexperimentgeneralizabilitiesneuroendocrinologygranulocytopoiesesnoninterchangeableunpleasant-smellingmethemoglobinemiasphotodisintegratedphotodisintegratesdendrochronologiessuperintelligenceshemoglobinopathieselectroretinogramselectroretinographcounteradvertising
...View all with 18 letters...
Phrases (451)
professional golfergeorge michael cohanelaeagnus latifoliainterior decoratinggeorge simon kaufmanpooecetes gramineusaegean civilisationgenus chamaecytisussemilunar cartilagegeorge westinghouse
...View all with 18 letters...
Words (33)
counterintelligenceunintelligibilitiesparthenogeneticallyencephalomeningitiscytopathogenicitiesgastroenterologicalgastroenterologistsgedankenexperimentsprefigurativenessesgentlemanlikenessesneuropharmacologieselectromagneticallymeningoencephaliticelectronegativitiesmeningoencephalitisovercommercializingelectroretinographselectroretinographyultrasegregationistcounteradvertisingsgood-neighbourlinessovergeneralizationsindefatigablenessesmicropaleontologiesantiferromagnetismsethnomethodologistsinterchangeablenesscounterinsurgenciesovolactovegetarianspaleoanthropologiesdisadvantagednessesdisadvantageousnessradioallergosorbentPhrases (336)
measuring instrumentaquilegia canadensisrejoicing over the lawcollective agreementalpine type of glaciergiles lytton stracheymeat-packing businesspierre-auguste renoirhandle with kid glovesorganization expense
...View all with 19 letters...
Words (15)
unintelligiblenessespolyphiloprogenitiveinterchangeabilitiesphiloprogenitivenessglomerulonephritidesneuroendocrinologiesneuroendocrinologistelectroretinographicultrasegregationistsroentgenographicallyuncompromisingnessescounterdemonstratingsyncategorematicallynephroangiosclerosiscounterintelligencesPhrases (253)
sweet-scented geraniumarcheological remainspast progressive tenseevergreen bittersweetbyelorussian languageambrose gwinett bierceaugustin eugene scribeneisseria gonorrhoeaebarthold georg niebuhrgeorges henri lemaitre
...View all with 20 letters...
Words (10)
straightforwardnessesinterchangeablenessesneuroendocrinologicalneuroendocrinologistsmeningoencephalitideselectroretinographiesoverintellectualizingantiferromagneticallyindistinguishablenessdisadvantageousnessesPhrases (251)
use of goods and servicesagglutinative languageadministrative hearinggasterosteus pungitiuselaeagnus augustifoliaspontaneous generationbillie jean moffitt kingstephen william hawkinginterlingual renditionbarthold george niebuhr
...View all with 21 letters...
Words (1)
philoprogenitivenessesPhrases (190)
gilbert keith chestertongregorian calendar monthtransient global amnesiaitalian vegetable marrowfoeniculum vulgare dulcefuture progressive tensehigh-density lipoproteinrepublic of guinea-bissauguatemalan monetary unitivan sergeevich turgenev
...View all with 22 letters...
Words (2)
electroencephalographicindistinguishablenessesPhrases (109)
gilbert and ellice islandsboeing b-52 stratofortresspharmacological medicinehippoglossus stenolepsisapium graveolens rapaceumcapital of papua new guineagottfried wilhelm leibnizbangladeshi monetary unittechnological revolutionkingdom of the netherlands
...View all with 23 letters...
Words (1)
electroencephalographiesPhrases (131)
carnegie mellon universitylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicenseunidentified flying objecttrip the light fantastic toecapture of fort ticonderogazollinger-ellison syndromebattle of the little bighornsir terence mervyn rattigan
...View all with 24 letters...
Phrases (76)
miguel de cervantes saavedradiamond wedding anniversaryfrancis scott key fitzgeralddistinguished service medalcentral intelligence agencyedmund john millington syngesecret intelligence serviceantonio allegri da correggioreligious society of friendsbeggar-my-neighbour strategy
...View all with 25 letters...
Phrases (64)
charlotte anna perkins gilmanfrances eliza hodgson burnettright atrioventricular valvebrassica oleracea gongylodespolicing and enforcement costhunting and gathering societyanton grigorevich rubinsteinmalignant neoplastic diseasepersonal information managersir charles scott sherrington
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (49)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinoffice of management and budgetaugustus welby northmore puginco-operative republic of guyanabeta-adrenergic blocking agentnuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joyce
...View all with 27 letters...
Phrases (52)
revolutionary people's strugglebusiness process reengineeringbureau of engraving and printingephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systembattles of lexington and concordcapital of serbia and montenegrodemocratic republic of the congofederal housing administration
...View all with 28 letters...
Phrases (28)
male internal reproductive organdisorganized type schizophreniaautomatic data processing systemsouth-central dravidian languagegiovanni pierluigi da palestrinareceived pronunciation languagehydrangea macrophylla hortensisautoclaved lightweight concretenational intelligence communityfrancisco jose de goya y lucientes
...View all with 29 letters...
Phrases (16)
reduced instruction set computingglutamic oxalacetic transaminasedepartment of energy intelligencerepublic of bosnia and herzegovinaaugust friedrich leopold weismanncomplex instruction set computingnontricyclic antidepressant drughenri rene albert guy de maupassantsisters of st. michael the archangel1st viscount montgomery of alamein
...View all with 30 letters...
Phrases (29)
bureau of intelligence and researchmarie louise elisabeth vigee-lebrunguiseppe fortunino francesco verdisidonie-gabrielle claudine colettepalestine liberation organizationpalestinian popular struggle frontelectromotive drug administrationislamic great eastern raiders-frontgeorges eugene benjamin clemenceaufemale internal reproductive organ
...View all with 31 letters...
Phrases (17)
african american vernacular englishpeople against gangsterism and drugsweakly interacting massive particlesergei aleksandrovich koussevitzkystraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languageisidore auguste marie francois comtecockcroft-walton voltage multiplieredmond louis antoine huot de goncourt
...View all with 32 letters...
Phrases (20)
linear-quadratic-gaussian controllermusical instrument digital interfaceinternational maritime organizationstandard generalized markup languageobject-oriented programming languageorganization of the oppressed on earthpityrogramma calomelanos aureoflavaelizabeth cleghorn stevenson gaskellprivilege against self incriminationgeneral agreement on tariffs and trade
...View all with 33 letters...
Phrases (22)
relational database management systemfederal national mortgage associationgeorge louis palmella busson du mauriernero claudius caesar drusus germanicusinterstitial cell-stimulating hormonefriedrich august kekule von stradonitzeuropean law enforcement organisationvena centralis glandulae suprarenalisfunctional magnetic resonance imaginghermann ludwig ferdinand von helmholtz
...View all with 34 letters...
Phrases (12)
revolutionary organization 17 novembercanadian security intelligence serviceimmaculate conception of the virgin marycockcroft and walton voltage multipliernational socialist german workers' partyimmigration and naturalization serviceanti-imperialist international brigadefederal law enforcement training centerballistic missile defense organizationsubacute sclerosing leukoencephalitis
...View all with 35 letters...
Phrases (10)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtnational geospatial-intelligence agencyalbert francis charles augustus emmanuelcriminal intelligence services of canadanatural language processing applicationtiberius claudius drusus nero germanicusdeclining balance method of depreciationunited states government printing officePhrases (7)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing servicedirectorate for inter-services intelligencegates of the arctic national park and preservebaron hermann ludwig ferdinand von helmholtzenzyme-linked-immunosorbent serologic assay