Words Containing: I,E,K,Y
(In Any Order)
There are 523 words,
637 phrases and
0 abbr's with
I,E,K,Y in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
| whiskey | 7 | 20 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
| hickeys | 7 | 19 | verb, nounv, n | |||||
noun • a small inflamed elevation of the skin; a pustule or papule; common symptom in acne • a temporary red mark on a person's skin resulting from kissing or sucking by their lover | ||||||||
| bikeway | 7 | 19 | nounn | |||||
noun • A bicycle lane or path. | ||||||||
| hickey | 6 | 18 | nounn | |||||
noun • a small inflamed elevation of the skin; a pustule or papule; common symptom in acne • a temporary red mark on a person's skin resulting from kissing or sucking by their lover | ||||||||
| skydive | 7 | 18 | verbv | |||||
verb • jump from an airplane and perform various maneuvers before opening one's parachute | ||||||||
| kylikes | 7 | 18 | nounn | |||||
noun • An Ancient Greek drinking cup with a stem, two handles, and a broad, shallow body | ||||||||
| skylike | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| mickeys | 7 | 18 | nounn | |||||
noun • (ethnic slur) offensive term for a person of Irish descent | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
yikeWords (60)
whiskeyskylinericketyskydivepinkeyeshriekykyanitedisyokekylikesivylikeskylikeeyelikeperkilypeskilybeyliksraylikekidneysleakilymickeyskyaniseyuckierkyanizedinkeysmisyokeyukkiertoylikejerkilyhickeyscrickeybikewayyolkierdickeysyerkinglekythieyewink
...View all with 7 letters...
Phrases (3)
key limekey ringsky diveWords (76)
unlikelymckinleytrickeryladylikevalkyriewickedlyteriyakiskydivercytokinebiweeklysneakilykilobytecheekilykeffiyehwhiskerydisyokedyuckiestyukkiestskydivedhymnlikeskylinesfreakilykeffiyaheyewinkskaffiyehquaylikeenskyingkielbasykyanisedkyanisesdisyokeskyanitesrekeyingkyanizedwhiskeys
...View all with 8 letters...
Phrases (9)
minor keyeye blinkmilk wheyinbus keykey fruittonic keyshift keycity desksilky elmWords (85)
yorkshirereykjavikkimberleykeynesianmonkeyingjockeyingdoohickeyjellylikeskywriterhyperlinkpuppylikesylphlikeberrylikeyuckinessfairylikeperikaryaskydiverskaffiyehsmonkeyishsyruplikeirksomelywalkyriesteriyakiskeffiyahskeffiyehsweakishlytrinketrykeynotinglackeyingkilocyclejerkinglyphysickedsketchilystreakilyivorylike
...View all with 9 letters...
Phrases (16)
like crazygin rickeysay hey kidmilk yieldmike tysonstrike payrelay linkdirty joketipsy cakethe skinny
...View all with 9 letters...
Words (68)
mistakenlybricklayerfreakishlyeukaryoticpernicketylawyerlikeunladylikedyskinesiatrotskyitedyskineticskylightedsneakinglykerygmatichyperlinksdoohickeyscockneyishcockneyismleukocytichackneyingperikaryalperikaryonskybridgeslymphokinekilocyclessemiweeklycherrylikeskywritersskywrittenkindlesslyhokypokiestinkertoysperjinketyperjinkitykidneylikewykehamist
...View all with 10 letters...
Phrases (26)
mt. mckinleyisle of skyegreek deitylady killerpyknic typetake it easykidney fernkidney wortknotty pinehobby knife
...View all with 10 letters...
Words (70)
yellowknifepersnicketyhypokalemiamonkeyshinehypokalemickinesiologykeyboardistsickeninglymoneymakingmerrymakingskepticallyyastrzemskitalkativelyhyperlinkedkeystrokingflyspeckingpiggybackedbricklayerskaryogamiesbookbinderychimneylikecytokineseskeyboardingkeypunchingcockneyfiedcockneyfiesdyskinesiasgimcrackerycockneyismsyuckinessesalkalimetrylymphokinesfactorylikelickerishlykaryologies
...View all with 11 letters...
Phrases (43)
louis leakeylike royaltybilly the kidpolicy makeralkyl halideclosely knitcelery stickannie oakleywhiskey neatwhiskey sour
...View all with 11 letters...
Words (54)
hyperkalemiahyperkineticholidaymakermoneymakingshyperkineseshyperkinesiahyperlinkingmonkeyshinesflickeringlymerrymakingskaryokinetickeyboardistsleukocytosishyperkinesiscockneyfyingdaydreamlikekymographieskremlinologyhydrokineticskyrocketinghypokalemiasbodycheckingkaryokineseskaryokinesisoutjockeyingkeyboardingspony-trekkingpinnywinklesbradykinesiastickybeakedkeystrokingsrevokabilityfairnytickleleukocytoticblackish-grey
...View all with 12 letters...
Phrases (34)
lickety splithockey clinicrisky ventureblink of an eyealfred kinseypatrick henrytake kindly toliterary workdonkey enginecylinder lock
...View all with 12 letters...
Words (33)
marketabilitypsychokineticpsychokinesisholidaymakersrekeyboardinghyperkinesiastiddledywinkspsychokineseskindheartedlykinematicallybradykinesiasstickybeakingblackberryingfairnytickleskitty-corneredclickety-clackclickety-clickjawbreakinglyhydrokineticsremarkabilitydostoyevskianknickknackeryunmistakeablypoikilothermykenyapithecussketchabilityjiggery-pokeryforeknowinglykinesitherapyprickly-leafedprickly-leavedkeratomycosispsychometrikaPhrases (45)
el iskandriyahbitter hickorymount mckinleythree kings' dayrichard leakeyanxiety attackbanking systemwhiskey bottlesilky wisteriakillarney fern
...View all with 13 letters...
Words (17)
hyperkeratoticbreathtakinglyhyperkeratosisearthshakinglyheterokaryosisheterokaryoticmegakaryocytichydrokineticalleukocytosisesblackberry-lilyblackberryingsvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketonekinematographyPhrases (61)
dimethyl ketoneveliky novgorodcapital of kenyablended whiskeyemily dickinsonturkey stuffingkyrgyz republicdynamic speakersouth yorkshirehenry kissinger
...View all with 14 letters...
Words (14)
heartbreakinglykinestheticallyankylostomiasesphenylketonuriccholecystokinintelekineticallyphenylketonuriaknowledgabilitycockneyficationkenogeneticallypoverty-strickenlymphoblast-likehuckleberryingsdiphenylketonesPhrases (53)
turkey drumstickcapital of turkeyalfred korzybskisecurity blanketandrei tarkovskywilliam mckinleymarketable yieldwilliam shockleygenus myxinikelafield hockey ball
...View all with 15 letters...
Words (8)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosisescholecystokininsknowledgeabilityPhrases (38)
strictly speakingfyodor dostoevskicapital of new yorkfriendly takeoverfamily gekkonidaeelwyn brooks whitepresident kennedyyellowfin croakersnowy tree cricketmockernut hickory
...View all with 16 letters...
Phrases (14)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykoaleksey maximovich peshkovfrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneylucy in the sky with diamondsayatollah ruholla khomeini
...View all with 24 letters...
Phrases (16)
francis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskymelville louis kossuth deweypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkovmikhail yurievich lermontov
...View all with 25 letters...
Phrases (12)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventory
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
