Words Containing: I,D,A,C,Y
(In Any Order)
There are 1,336 words,
1,890 phrases and
0 abbr's with
I,D,A,C,Y in.
Best Scoring Words With: I,D,A,C,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
oxyacid | 7 | 20 | noun, adjectiven, adj | |||||
noun • any acid that contains oxygen | ||||||||
diarchy | 7 | 16 | nounn | |||||
noun • a form of government having two joint rulers | ||||||||
acidify | 7 | 16 | verbv | |||||
verb • make sour or more sour • turn acidic | ||||||||
dynamic | 7 | 15 | adjectiveadj | |||||
adjective • characterized by action or forcefulness or force of personality • of or relating to dynamics • (used of verbs (e.g. `to run') and participial adjectives (e.g. `running' in `running water')) expressing action rather than a state of being noun • an efficient incentive | ||||||||
diptyca | 7 | 15 | ||||||
Valid word for Scrabble US
| ||||||||
mediacy | 7 | 15 | nounn | |||||
noun • the quality of being mediate | ||||||||
dryadic | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
dyadics | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
cyanide | 7 | 13 | nounn | |||||
noun • any of a class of organic compounds containing the cyano radical -CN • an extremely poisonous salt of hydrocyanic acid | ||||||||
acidity | 7 | 13 | nounn | |||||
noun • the property of being acidic • the taste experience when something acidic is taken into the mouth • pH values below 7 | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
acidyWords (56)
delicacydynamicsaudacitycandidlydynasticcaddyingplacidlyanodyniccaryatidcyanideshyracoiddecayingecdysialadynamicsyndicaloxyacidshypoacidradiancycyanideddialyticdactyliccandyingcymbidiadiptycasdystociacyanamidhydraciddeviancydiacetyldyarchiccaducityrancidlypycnidiadidactylcityward
...View all with 8 letters...
Phrases (4)
dairy cowbasic dyewild cavycivil dayWords (106)
syndicatediplomacyradicallymedicallyhydrauliccandidacychlamydiajudiciarycordiallyayurvediccharybdisyardstickfiduciaryimmediacymendacityranciditycyanidingbrickyardchrysalidplaciditymydriaticflaccidlyadipocytehyracoidsdichogamydyscrasiadeacidifycaddisflycaddishlydecimallydyscrasicdyscraticdecalcifyedictallyecdysiast
...View all with 9 letters...
Phrases (8)
mint candycubic yardrice paddyrapid citycandy kissfatty acidwild claryhybrid carWords (135)
dictionaryhydraulicsincendiarydelicatelypiccadillysyndicatedinadequacycardiologymyocardiummyocardialsuicidallycyclopediadeclassifycordialitydespicablyindelicacybiodynamicmendicancyjudicatoryflaccidityanodicallyacrylamideadipocytesimmoderacyayurvedicsbrickyardsyardsticksdynamisticacidifyingdyscrasiasuncandidlysyndicatescyanamidesdysphasicsacidimetry
...View all with 10 letters...
Phrases (17)
canary birdchalcid flycall it a daycrown daisyoxygen acidvictory daybinary codethymic acideye dialectchild's play
...View all with 10 letters...
Words (180)
accordinglydrasticallydiscrepancyaerodynamictachycardiapredictablyvaledictorysyndicationcylindricalpsychedeliamelodicallycrystalloididenticallyhydrocyanicdynamicallyidioticallyhemodynamicsecondarilycomedicallybradycardiasyndicalistmyocarditishomicidallytragicomedymedicinallycardiopathypyramidicalcyclopaediacyclopediasveridicallycordwainerysyndicatingsyndicatorspiggybackededucability
...View all with 11 letters...
Phrases (33)
dry cleaningvictoria dayacrylic aciddisplay casecome in handyconey islandplaying cardpyruvic acidgrey catbirdchicken yard
...View all with 11 letters...
Words (196)
accidentallyincidentallydramaticallydisciplinaryconsiderablyencyclopediaperiodicallyaerodynamicscrystallizedacademicallydomesticallymethodicallyhypochondriahyperaciditydiscordantlysporadicallysadisticallyhydrographicindelicatelycardiomegalyphotodynamichydrodynamicinadvertencyferricyanidehydrologicaldogmaticallyidiosyncrasycrystallisedpedanticallydiabolicallydepreciatorycardiographymendaciouslydenunciatorysyndactylism
...View all with 12 letters...
Phrases (67)
scantily cladchristmas dayascension daygenus cydoniadevil-may-caredramatic playsalivary ductacid hydrogenalkyl radicalcare delivery
...View all with 12 letters...
Words (190)
dysfunctionalcontradictoryradioactivityhypochondriacparadoxicallyideologicallydiscretionaryencyclopaediaidiosyncratichydraulicallyeducationallythermodynamicdiametricallyindescribablydisgracefullyhydrodynamicsrhapsodicallyindeterminacypolydactylismendolymphaticconsideratelyspasmodicallyhydrocephalicencyclopaedicunpredictablycreditabilityclandestinelyradioactivelyconditionallydiscreditablypedagogicallybasidiomycetedelectabilitydictatoriallyencyclopedias
...View all with 13 letters...
Phrases (75)
direct antonymfamily picidaecardiac rhythmuranyl radicalcanary islandsdata hierarchycretan dittanygenus dactylisbenzyl radicalcelestial body
...View all with 13 letters...
Words (176)
coincidentallydemocraticallycardiomyopathyconfidentiallythermodynamicsdiscriminatorypredictabilitypsychodynamicsdiplomaticallyappendicectomyinconsiderablyidealisticallyhydropneumaticorthopedicallydiagnosticallydirectionalitydisconsolatelyconsuetudinarycyproheptadinediscouraginglyparadisiacallyhedonisticallyelectrodynamicidiosyncrasiesincandescentlyhydrocolloidalhydrodynamicalimmethodicallyantidromicallyrecrystallizedadrenergicallypolyacrylamidehydrologicallyencyclopaediasdissociability
...View all with 14 letters...
Phrases (121)
order mysidaceapolymeric amidedata encryptiondynamic balancedynamic speakerbinary compoundmass deficiencyradio frequencyhenry cavendishanser cygnoides
...View all with 14 letters...
Words (129)
confidentialityunconditionallyaerodynamicallycardiopulmonarylackadaisicallydramaturgicallyhypochondriacalgynandromorphicdemographicallyinconsideratelyperpendicularlyaccommodatinglybidirectionallysemidocumentarydemystificationpsychedelicallyhydromechanicalpolysaccharidesdisenchantinglycyproheptadineshydrobiologicalsophisticatedlyradiometricallysemicylindricalcoeducationallypolyacrylamidesreduplicativelycontradictorilydyslogisticallysynecdochicallyaerodynamicistsdecarboxylationhypochondriasesdecarboxylatingdithyrambically
...View all with 15 letters...
Phrases (151)
auditory ossicledialysis machineannunciation dayadvisory servicejohn quincy adamsfamily astacidaedasyprocta agutihydrocyanic acidamebic dysenteryindependence day
...View all with 15 letters...
Words (52)
indiscriminatelyunpredictabilitydiscriminatorilyparadigmaticallyjurisdictionallyradiographicallyunconditionalityperpendicularitycyclophosphamidehydrocharidaceaehydrocharitaceaedecarboxylationsdodecaphonicallypharmacodynamicsechocardiographyindescribabilityundiplomaticallyelectrohydraulicdysfunctionalitydemystificationscarboxypeptidasehendecasyllabicscardiomyopathiesphotodynamicallyundemocraticallycryptobranchidaeancylostomatidaeencyclopedicallyhomoscedasticityhydrodynamicallynoncontradictoryhydrodynamicistsdiacetylmorphinesympathectomizednondiscretionary
...View all with 16 letters...
Phrases (164)
family cyprinidaecardiac glycosidepodocarpus familyfamily locustidaeschool dictionaryright to candidacyfamily buccinidaeaerodynamic forcefamily formicidaemonosyllabic word
...View all with 16 letters...
Words (40)
parathyroidectomycardiorespiratorythermodynamicallymultidisciplinaryinterdisciplinaryself-contradictoryradiobiologicallycercidiphyllaceaekaleidoscopicallyradioisotopicallyhypochondriacallyidiosyncraticallydisrespectabilitytransdisciplinarycyclophosphamidesdehydrochlorinasesamoyedic-speakingdehydrochlorinatephonocardiographyptilonorhynchidaeaerothermodynamicturbidimetricallydesynchronisationdesynchronizationcarboxypeptidasesdeoxyribonucleaseangiocardiographyornithorhynchidaephotoperiodicallydeterministicallyepidemiologicallyhydroelectricallydialectologicallydiaphragmaticallypsychodynamically
...View all with 17 letters...
Phrases (182)
lycopodium alpinumantipsychotic drugcylinder separatorcylindrical liningfamily trochilidaecaesarian deliverycapital of marylandfamily droseraceaesanitary conditionsubsidiary company
...View all with 17 letters...
Words (14)
cylindrical-stemmedlipopolysaccharidemucopolysaccharidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesaerothermodynamicsdeoxyribonucleasespropagandisticallyhomobasidiomyceteshydrometallurgicalsedimentologicallyindiscriminatinglydiethylcarbamazinePhrases (161)
bombycilla cedrorundivision cynodontiafreudian psychologyread-only memory chipfamily trichechidaefamily desmidiaceaesolid body substancevictory in europe dayapodemus sylvaticusphoenix dactylifera
...View all with 18 letters...
Words (20)
hydrochlorothiazideparathyroidectomiesmucopolysaccharideslipopolysaccharidescytodifferentiationindividualisticallymagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedcontradistinctivelyencephalomyelitideshydroxytetracyclinehydrometeorologicaldiethylcarbamazineshypoadrenocorticismelectrocardiographyPhrases (186)
acetylsalicylic acidfamily cyclopteridaescandinavian countryfamily cynoglossidaehydrastis canadensisfamily dasyproctidaedivision schizophytabond-trading activitynancy freeman mitfordcalycanthus floridus
...View all with 19 letters...
Words (12)
tetrahydrocannabinolparathyroidectomizedhyperadrenocorticismcytodifferentiationsmagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesmagnetohydrodynamicsencephalomyocarditishydrochlorothiazidesheterobasidiomycetesPhrases (161)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaedivision tracheophytaclyde william tombaughfamily dermochelyidaedianthus caryophyllussuricata tetradactylafamily pseudococcidae
...View all with 20 letters...
Words (3)
mucopolysaccharidosisdendrochronologicallytetrahydrocannabinolsPhrases (103)
icelandic monetary unitdesoxyribonucleic acideucalyptus fraxinoidescambodian monetary unitprocaine hydrochloridehenry hobson richardsonsamuel taylor coleridgefamily myrmecophagidaefederal security bureaucape verde monetary unit
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (98)
trazodone hydrochloridefamily dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianmale reproductive systembrachycome iberidifoliafamily branchiostomidaecombined dna index systemedna saint vincent millayamygdalus communis amara
...View all with 22 letters...
Words (1)
electrocardiographicallyPhrases (60)
argyroxiphium sandwicensesubdivision deuteromycotamary wollstonecraft godwinprivately held corporationapocynum androsaemifoliumantiarrhythmic medicationtechnology administrationfederal republic of germanysir charles leonard woolleyandrei andreyevich gromyko
...View all with 24 letters...
Phrases (44)
igor fyodorovich stravinskyfrancis scott key fitzgeraldpolystichum acrostichoidescaulophyllum thalictroidesandrei arsenevich tarkovskylepidocybium flavobrunneumtympanuchus pallidicinctusreticuloendothelial systemnational academy of sciencessystematic desensitisation
...View all with 25 letters...
Phrases (40)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency viruscharles maurice de talleyrandrevolutionary calendar monthsubdivision basidiomycotinasubdivision coniferophytinasubdivision deuteromycotinasubdivision mastigomycotina
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (26)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkincommissioned military officertricyclic antidepressant drugtopical prostaglandin eyedropatrioventricular nodal rhythmhydraulic transmission systempolyostotic fibrous dysplasia
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (19)
aleksandr feodorovich kerenskyoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulose
...View all with 28 letters...
Phrases (17)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemhydrangea macrophylla hortensisfrancisco jose de goya y lucientestheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (13)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidwaterhouse-friderichsen syndromesevere acute respiratory syndromenontricyclic antidepressant drugtechnical analysis of stock trendsbasic point defense missile systemacute inclusion body encephalitis
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (9)
digital communications technology2019-ncov acute respiratory diseaserecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasvladimir vladimirovich mayakovskidefense information systems agencymary godwin wollstonecraft shelleyPhrases (9)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatetheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensisamaranthus hybridus erythrostachysacquired immune deficiency syndromePhrases (8)
nondepository financial institutionright to speedy and public trial by jurysecretary of health and human servicessubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay