Words Containing: I,C,H,I,N,G,S
(In Any Order)
There are 339 words,
597 phrases and
0 abbr's with
I,C,H,I,N,G,S in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| squinching | 10 | 25 | verb, nounv, n | |||||
verb • To scrunch up (one's face, etc.). | ||||||||
| physicking | 10 | 25 | verbv | |||||
verb • To cure or heal. • To administer medicine to, especially a purgative. noun • Medication | ||||||||
| nightstick | 10 | 20 | nounn | |||||
noun • a short stout club used primarily by policemen | ||||||||
| cherishing | 10 | 19 | verb, adjectivev, adj | |||||
verb • be fond of; be attached to | ||||||||
| wingchairs | 10 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| switching | 9 | 18 | verbv | |||||
noun • the act of changing one thing or position for another | ||||||||
| hygienics | 9 | 18 | nounn | |||||
noun • the science concerned with the prevention of illness and maintenance of health | ||||||||
| chamoising | 10 | 18 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| scraiching | 10 | 18 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| clingfish | 9 | 18 | nounn | |||||
noun • very small (to 3 inches) flattened marine fish with a sucking disc on the abdomen for clinging to rocks etc. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (37)
nightstickcushioningchastisingcherishingchamoisingsquinchingphysickingcashieringschillingsscraichingscraighingarchaisingchisellingwingchairstwitchingsscreichingscreighingchicaningschicklingsstitchingsscriechingchieflingschromisingmachiningswickthingshistogenicshriechingcipheringschiliagonsscritchingflinchingshijackingsshritchingethicisingchiackings
...View all with 10 letters...
Phrases (1)
wishing capWords (48)
christeningcholangitisfranchisingrestitchingdischargingdispatchingbesmirchingmischoosingcatechisingsandwichingchainsawingmispatchingthickeningsmischargingschizogonicmisteachingclingfishesichnologiesmistouchingmismatchingnightstickscrawfishingunstitchingeunuchisingchristinglerhotacisinggothicisingdisvouchingcashieringsmischancingheroicisingalchemisingmischiefingfetichisingscomfishing
...View all with 11 letters...
Phrases (3)
genus litchichafing dishsucking fishWords (46)
chitterlingsphysiognomicschematizingchristeningschemisorbingspeechifyinghemstitchingshipwreckingchecklistinghaircuttingshistogeneticschizogoniesscrimshawingcopublishingscintigraphystanchioningdisbranchingkitschifyingchimichangaslocksmithingtopstitchingchloridisingchristinglesdischurchingchlorinisingdisanchoringbackshishingschematisingcinchonisingstrychniningchannelisingchirognomiestechnicisingcherishinglyalcoholising
...View all with 12 letters...
Phrases (13)
isamu noguchicarangid fishswitch enginebasic englishgenus inachisriding schoolsingle stitchfishing smacksewing stitchswinging chad
...View all with 12 letters...
Words (62)
merchandisingsynchronisingsynchronizingdisenchantingwhipstitchingaccomplishingiconographiesmischannelingschismatizingblacksmithingsaccharifyingenfranchisingrechristeninglockstitchingstickhandlingcockfightingshistaminergicbackstitchingchildbearingslichenologieslichenologistscintigraphichistoricizingclothesliningcollieshangieswitchbackinglocksmithingsachromatisinghemming-stitchcatholicisingmarischallinghispanicisinghispanicizingphonemicisingschillerising
...View all with 13 letters...
Phrases (24)
straight chainchiang kai-shekspring chickenshipping clerkthrowing stickripping chiselmarching musicrunning stitchfishing tacklelaunching site
...View all with 13 letters...
Words (41)
characterisingantiphlogisticdisfranchisingmischannellingblacksmithingspsychologizingelectrofishingsophisticatingmerchandizingsphysiognomicallichenologistsscintigraphiespsychologisingcollieshangiesaestheticizingpsycholinguistmerchandisingschristianisingthymectomisingtrichotomisingchristianizinggigantomachiasgigantomachiespredischargingtechnicalisingparochialisinghistogenicallyscrimshandyingparchmentisingtechnologisingcoachbuildingswinding-clothessycophantisingsycophantizingchronologising
...View all with 14 letters...
Phrases (28)
fishing licencefishing licensehunting licenseriding breechesignition switchswaging machineshipping officesueding machineright ascensiongenus chilopsis
...View all with 14 letters...
Words (29)
disenchantinglyhypervigilanceschangeabilitieshallucinogenicsmicropublishingbiotechnologiesbiotechnologistpsycholinguistschronobiologieschronobiologistelectrofishingspathogenicitiesantiphlogisticstheatricalisingcorinthianisingmetaphysicisingscrimshanderingmetaphysicizingautoschediazingmathematicisingdesynchronizinghieracosphingesscratchbuildingresynchronisingresynchronizingpachymeningitisnephrectomisingphlogisticatingethnolinguisticPhrases (51)
high renaissancefriedrich engelsgenus chinchillaenglish civil warfiring mechanismhorseback ridingsocial gatheringthree-ring circusch'in shih huang tichange intensity
...View all with 15 letters...
Words (18)
disenfranchisingantitechnologiesfeatherstitchinglymphangiectasialymphangiectasisbiotechnologistsneurophysiologicsuperencipheringanticholinergicschoriomeningitisphysiognomicallyanglo-catholicismchronobiologistssemipornographiccinematographiesmicropublishingspsycholinguisticbranchiostegidaePhrases (52)
christian huygensexercising weightpolishing machinegenus zonotrichiaerwin schrodingerthreshing machineschematic drawingallergic rhinitisgenista hispanicadecoction mashing
...View all with 16 letters...
Words (10)
psycholinguisticscontradistinguishstraightjacketingphotodissociatingunchangeabilitiescholangiographiesethnomusicologiesethnomusicologistexchangeabilitiesmischaracterizingPhrases (46)
antipsychotic drugengineering schoolplastering machinegenus aristolochiasteering mechanismbosna i hercegovinaaustrian schillingsergei rachmaninovpublishing companylegislative branch
...View all with 17 letters...
Words (4)
hypophysectomizingethnomusicologicalethnomusicologistsneurophysiologicalPhrases (43)
antipsychotic agentthanksgiving cactusgenus citharichthysscottish highlandergeophysical sciencesergei rachmaninoffinstallation chargewhispering campaignphotogenic epilepsyinorganic chemistry
...View all with 18 letters...
Words (7)
encephalomeningitiscytopathogenicitiesphonocardiographiescontradistinguishedcontradistinguishesmeningoencephalitisangiocardiographiesPhrases (42)
irish gaelic languageuniversity of chicagodolichotis patagonumharmonic progressioncapital of washingtonautotrophic organismmalpighian corpusclehousing commissionersaprophytic organismisaac bashevis singer
...View all with 19 letters...
Words (4)
interchangeabilitiesneurophysiologicallycontradistinguishingnephroangiosclerosisPhrases (38)
archeological remainsphotographic emulsionsecond coming of christgenus phoenicophoriumluscinia megarhynchosgleditsia triacanthospass with flying colorssaturday night specialcapital of afghanistansedative-hypnotic drug
...View all with 20 letters...
Words (2)
meningoencephalitideselectroretinographiesPhrases (42)
anaphalis margaritaceaigor ivanovich sikorskyarithmetic progressionchionanthus virginicusspeech intelligibilitywilliam schwenk gilbertmicrofinishing machinethoracoepigastric veinstone splitting machineamerican smooth dogfish
...View all with 21 letters...
Words (1)
laryngotracheobronchitisPhrases (20)
argyroxiphium sandwicensetrip the light fantastic toedistinguished flying crossarthur meier schlesinger jr.gioacchino antonio rossinitechnology administrationconstitutional psychologyaccessory hemiazygous veingastrophryne carolinensisvena hemiazygos accessoria
...View all with 24 letters...
Phrases (19)
igor fyodorovich stravinskydistinguished service medalcharles frederick menningergreat plains of north americaprairie white-fringed orchissecond marquis of rockinghamsuperorder acanthopterygiiislamic state of afghanistandistinguished conduct medaldistinguished service cross
...View all with 25 letters...
Phrases (13)
charlotte anna perkins gilmanhunting and gathering societyanton grigorevich rubinsteinsir charles scott sherringtonalpine enchanter's nightshadebenign prostatic hyperplasiachristoph willibald von gluckplastic blow moulding machinefollicle-stimulating hormonethyrotropin-releasing factor
...View all with 26 letters...
Phrases (12)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkincryptobranchus alleganiensistaras grigoryevich shevchenkothrough empirical observationdianthus chinensis heddewigiihypothalamic releasing factorgeorgi konstantinovich zhukovlymphocytic choriomeningitisinhalation general anesthetic
...View all with 27 letters...
Phrases (19)
ephippiorhynchus senegalensisgallinula chloropus cachinnansdistinguishing characteristicgrace ethel cecile rosalie allensergei mikhailovich eisensteincongregation of the inquisitionsingle nucleotide polymorphismhypothalamic releasing hormoneinhalation general anaestheticgates of the arctic national park
...View all with 28 letters...
Phrases (1)
subacute sclerosing leukoencephalitisPhrases (1)
angiotensin-converting enzyme inhibitorPhrases (1)
congregation of the sisters of saint hedwig
