Words Containing: I
There are 176,722 words,
45,224 phrases and
350 abbr's with
I in.
Best Scoring Words With: I
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| pizzazz | 7 | 45 | nounn | |||||
noun • the activeness of an energetic personality | ||||||||
| pizazzy | 7 | 39 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| pizazz | 6 | 35 | nounn | |||||
noun • Flair, vitality, or zest; energy; vigor. | ||||||||
| quizzed | 7 | 35 | verb, adjectivev, adj | |||||
noun • an examination consisting of a few short questions verb • examine someone's knowledge of something | ||||||||
| jazzily | 7 | 35 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| pizzaz | 6 | 35 | nounn | |||||
noun • the activeness of an energetic personality | ||||||||
| zizzled | 7 | 35 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| quizzes | 7 | 34 | nounn | |||||
noun • An odd, puzzling or absurd person or thing. • A competition in the answering of questions. • A school examination of less importance, or of greater brevity, than others given in the same course. verb • To hoax; to chaff or mock with pretended seriousness of discourse; to make sport of, as by obscure questions. • To peer at; to eye suspiciously or mockingly. • To question closely, to interrogate. • To instruct by means of a quiz. • To play with a quiz. | ||||||||
| jacuzzi | 7 | 34 | nounn | |||||
noun • A hot tub or whirlpool bath with underwater jets that massage the body. verb • To equip with a jacuzzi. • To use a jacuzzi. • To treat with a jacuzzi. | ||||||||
| zizzles | 7 | 34 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
iWords (1212)
thiswithlikewilltimegivesaidlifewaitfindintonicegirlfinekindlivemindwifemissideafiveminehighsidewishfirecitylinesickpickhairkingfilmsingtill
...View all with 4 letters...
Phrases (12)
cu into iton ita bitin ondo indo itsq inbig hli po
...View all with 4 letters...
Abbreviations (208)
ninathairicotitootisohiomarilizanilepitt
...View all with 4 letters...
Words (3869)
rightthinkgoingdoingfirstthingagainstilltheirnightwhichbeingmightbringsincewhiledrinkuntiltimesmusicchildpointfightquitelighttriedalivewhitewritedrivelivesquiettiredmoviepiece
...View all with 5 letters...
Phrases (64)
zip upget itin allon airput intip ini. m. peifix upin usee. coli
...View all with 5 letters...
Abbreviations (1)
calif.Words (8703)
littlethingslistencomingfriendfamilytryingpolicesayinginsidehavingsisterminutetakingafraidmakingbehindlivingeitherofficedinneraskingfinishladiesseeingmovinggivingduringchoicesinglemiddlesimplechristfigurecrying
...View all with 6 letters...
Phrases (251)
air bagcup tiewild oxkit outhip padrail intin earpipe infire uprise up
...View all with 6 letters...
Words (16830)
nothingbelievetalkinglookingwithoutgettingmorningtonightworkingwaitingminutesmarriedagainstalrightoutsidepromiseseriousleavingplayingtellingfeelingspecialmillionrunninghimselfeveningmeetingfinallycallingpicturecaptainexplainkiddingforgivewedding
...View all with 7 letters...
Phrases (666)
air basedie downair cellpin curldrill inmail outcon brioair ductsea lilyair flow
...View all with 7 letters...
Abbreviations (1)
lgbtqia+Words (23559)
anythingbusinessthinkingchildrenquestionhospitalpossiblestraightbirthdaylaughingfinishedwatchingbuildingamericanaccidentmarriagespeakingsecurityterriblesleepingsurprisecontinueevidencefightingstandingpositionpromisedstartinginvolveddrinkingdirectordecisionprincessmilitaryshooting
...View all with 8 letters...
Phrases (1215)
white antold irishauto tirefilm clipw. c. fieldsin a flashfilm fernold latinfield hutfish lure
...View all with 8 letters...
Words (26734)
somethingbeautifuldifferentimportantsometimeshappeningpresidentchristmasdifficultboyfriendattentionsituationseriouslycertainlybeginninglisteningotherwisescreamingdetectiveobviouslyfollowingfantasticaccordingwonderingapologizesurprisedintroduceoperationexpensiverecognizehappinessbrilliantconditioninterviewpolitical
...View all with 9 letters...
Phrases (2029)
high pitchstill lifehigh pointlouis kahnin a bad waymount fujising alongfelis oncalittle aukmanila bay
...View all with 9 letters...
Words (25562)
everythinggirlfriendinteresteddefinitelyimpossibleespeciallydifferenceexperienceappreciateridiculousincrediblelieutenantuniversitydisgustingdownstairsdiscoveredtelevisionpermissionparticularconnectionfriendshipprotectionconsideredproductioncaliforniarevolutionwashingtonconfidencepunishmentreputationgenerationimpressivechatteringattractiveconditions
...View all with 10 letters...
Phrases (2835)
fossil fuelshah of iranhindu deityrhone riverstone fruitmarking inkcook straitgenus inuladisk accesshigh relief
...View all with 10 letters...
Words (22245)
informationinterestingimmediatelyresponsibleopportunitycomplicatedappointmentcompetitioncoincidenceelectricityimaginationenvironmentintelligentexplanationpossibilitydestructionanniversarythreateningpersonalityconsideringexperiencedpracticallyauthoritiesapproachingdifferentlyforgivenessindependentfascinatingnecessarilyappropriatecomplainingtechnicallyinvestigatecelebratingtraditional
...View all with 11 letters...
Phrases (3542)
isaac singeraquila rapaxgenus myxinegrass familylaying claimbeam of lightbitter aloescatha edulisleave officehigh profile
...View all with 11 letters...
Words (17147)
relationshipconversationprofessionalunbelievableneighborhoodintelligenceembarrassingdisappointedconstructionorganizationparticularlysurveillanceinstructionscommissionerchampionshippsychiatristspecificallycivilizationpresentationindependenceaccomplishedaccidentallyregistrationinstrumentalintellectualprescriptionconstitutionoccasionallytransmissionthanksgivingsatisfactionconfidentialpsychologistrefrigeratorkindergarten
...View all with 12 letters...
Phrases (3929)
louis jollietrun-of-the-millpole vaultingelihu thomsonalec guinnessmeasuring rodmortise jointold ironsidesel libertadorpitt the elder
...View all with 12 letters...
Words (12407)
investigationinternationalunderstandingcircumstancesextraordinaryentertainmentcommunicationinvestigatingconsciousnesspsychologicalrevolutionarydemonstrationconcentrationapproximatelyneighbourhoodsophisticatedinterrogationirresponsibleestablishmentmisunderstoodgrandchildreninappropriateassassinationconsiderationunderestimateenvironmentaldisappearanceautomaticallymisunderstanddeterminationauthorizationunpredictabledistinguisheddisappointinginconvenience
...View all with 13 letters...
Phrases (4176)
john masefieldbakke decisionupton sinclairpartial breachfelis concolorharvey cushingaleatory musicoutside clinchpaul hindemithel iskandriyah
...View all with 13 letters...
Words (8417)
responsibilityadministrationcommunicationsrepresentativeidentificationtransportationdisappointmentrecommendationsuperintendenttransformationinterpretationpharmaceuticalsimultaneouslyrepresentationrehabilitationprofessionallydiscriminationadministrativeconstitutionalreconstructionscientificallyreconciliationinfrastructurecharacteristicreconnaissanceunprofessionalczechoslovakiahypotheticallycongratulationaccomplishmentclaustrophobiccinematographycircumstantialarchaeologicalpsychoanalysis
...View all with 14 letters...
Phrases (4324)
blood poisoningfamily apiaceaefertilized ovumgalileo galileiimperative formalpine clubmossitalian capitalnegeri sembilanimperative moodpearl mae bailey
...View all with 14 letters...
Words (5445)
congratulationselectromagneticstraightforwardpsychologicallyconfidentialityextraordinarilyrevolutionariesinternationallycinematographerprofessionalismexperimentationunconditionallyinsubordinationextracurricularpsychotherapistunconsciousnessdissatisfactionmethamphetaminetechnologicallynotwithstandingunintentionallyinstantaneouslysynchronizationenvironmentallypithecanthropusunderprivilegeddecontaminationophthalmologistconfrontationalpersonificationentrepreneurialinappropriatelyintussusceptionunsophisticatedhospitalization
...View all with 15 letters...
Phrases (4101)
malaria parasitemeasuring devicesyringa vulgarisallium carinatumauditory ossiclepanel discussionfelis domesticusby fits and startsstay of executioniridaceous plant
...View all with 15 letters...
Words (1975)
misunderstandingextraterrestrialincomprehensibleunconstitutionalenthusiasticallyintercontinentalenvironmentalistindiscriminatelydisqualificationautobiographicalanesthesiologistelectromagnetismmultimillionaireirresponsibilitycounterterroristdisproportionateneurotransmittergastrointestinaltransilluminatorundersecretariesconstitutionallytranscontinentalincontrovertiblecounterclockwisehemorrhoidectomycharacterizationmisappropriationincomprehensiblyaustralopithecusenvironmentalismmultidimensionalcounteroffensiveprestidigitationcounterterrorismpseudoscientific
...View all with 16 letters...
Phrases (3522)
hypodermic needletympanic membranemultiengine planecommedia dell'arteczar alexander iiigenus utriculariaarteria vaginalismanihot esculentacapital of finlanddame kiri te kanawa
...View all with 16 letters...
Words (1134)
institutionalizedcounterproductiveindistinguishableimmunosuppressionstraightforwardlydepersonalizationtelecommunicationimmunosuppressiveconversationalistcommercializationcounterinsurgencyindustrializationmisinterpretationintergovernmentalmisidentificationunconventionalitybacteriologicallyimmunosuppressanttranscendentalisminstitutionalisedmisrepresentationcounterrevolutionconscientiousnesssuperconductivityelectrocardiogramdeconstructionistconstitutionalityelectroconvulsiveanthropologicallycompartmentalizedparathyroidectomyreconstructionismmaterialisticallyreconstructionisttransillumination
...View all with 17 letters...
Phrases (3213)
horizontal sectioncapital of ethiopiawilliam stricklandcastilian languageobject recognitiongopherus agassiziiheat of sublimationjacqueline cochranmanihot utilissimalarix occidentalis
...View all with 17 letters...
Words (597)
telecommunicationscharacteristicallydisproportionatelycompartmentalizinginternationalizinganthropomorphizinginconsequentialityhypercoagulabilitygastroenterologisttransubstantiationinterconnectednessoversimplificationtransmogrificationpsychopathologicalspectrophotometricantivivisectionistinstitutionalizinghyperaldosteronismdisenfranchisementoverrepresentationinterchangeabilitysociopsychologicalneuropsychologicalpaleoclimatologistinexpugnablenessesthermoluminescenceunintelligiblenesshypersensitivenesspolyesterificationcoccidioidomycosisexterritorialitieshypersensitivitieshypersensitizationradiochromatogramscommensurabilities
...View all with 18 letters...
Phrases (2736)
hindu calendar monthbombycilla cedrorunworldly possessionsbusiness enterprisebombycilla garrulusarteria vertebraliswashington monumentoceanites oceanicusdouble-deck carriageprofessional golfer
...View all with 18 letters...
Words (356)
counterintelligencehyperparathyroidismhydrochlorothiazidesternocleidomastoidpsychophysiologicalpseudohermaphroditeelectroluminescenceintellectualizationcinematographicallystraightforwardnessspectrofluorometricunintelligibilitiesthermoluminescencespolyesterificationsdisenfranchisementsthermoperiodicitieshypersensitizationsextralinguisticallycountersurveillanceextraordinarinessespolyribonucleotidesprofessionalisationotorhinolaryngologyextraterritorialityhypersusceptibilityunpretentiousnessesprofessionalizationantivivisectionistsspectrophotometriesparathyroidectomiesultracentrifugationnonproductivenessessurface-assimilativecommunicativenesseshypolipoproteinemia
...View all with 19 letters...
Phrases (2134)
building supply housewater-plantain familymeasuring instrumentacetylsalicylic acidrecursive definitionfavourable receptionmuscular contractionerinaceus europeaeusallium cepa viviparumaquilegia canadensis
...View all with 19 letters...
Words (168)
counterrevolutionaryuncharacteristicallycompartmentalizationinstitutionalizationhypercholesterolemiaanthropomorphizationoverenthusiasticallyinternationalizationtetrahydrocannabinolparadichlorobenzenesspectrofluorometriessemiautobiographicalunintelligiblenesseshypersensitivenessesspectroheliographiespolyphiloprogenitiveradioimmunoassayablekeratoconjunctivitesradiopharmaceuticalscountersurveillancesspectrophotometricalparathyroidectomizedabetalipoproteinemialipochondrodystrophyunrepresentativenesscounter-revolutionistunsatisfactorinessescrystallographicallyreconceptualizationshyperadrenocorticismcomprehensiblenessesindistinguishabilitycounterdemonstrationcytodifferentiationstransformationalists
...View all with 20 letters...
Phrases (1629)
william stanley jevonssuborder strepsirhinisweet-scented geraniumarcheological remainsallium cepa aggregatumblack-capped chickadeecalendula officinalisgilbert charles stuarthonduran monetary unityellow-shafted flicker
...View all with 20 letters...
Words (63)
psychopharmacologicalhypogammaglobulinemiadisestablishmentarianotorhinolaryngologistextraterritorialitieshypersusceptibilitiescompartmentalizationsinstitutionalizationsstereomicroscopicallymultidimensionalitiesimmunocytochemistriesconstructive-metabolicstraightforwardnessesimmunoelectrophoresesimmunoelectrophoreticmucopolysaccharidosisestablishmentarianisminterchangeablenessesconstitutionalizationelectrocardiographiesacetylcholinesterasespseudohermaphroditismneuroendocrinologicalneuroendocrinologistsinterconvertibilitiesadrenocorticosteroidsadrenocorticotrophinsotorhinolaryngologiesmeningoencephalitideselectromyographicallybuckminsterfullerenesdendrochronologicallyovercommercializationinternationalizationsimmunoelectrophoresis
...View all with 21 letters...
Phrases (1236)
use of goods and servicesacrocentric chromosomesir john everett millaisagglutinative languagesierra madre occidentaladministrative hearingelimination tournamentdissolution of marriagesierra nevada mountainsdirect electric current
...View all with 21 letters...
Words (26)
counterrevolutionarieskeratoconjunctivitideskeratoconjunctivitisesdisestablishmentariansspectrophotometricallyunrepresentativenessesnonrepresentationalismimmunohistochemistriesreinstitutionalizationconstitutionalizationsphiloprogenitivenessesintercomprehensibilitydeinstitutionalizationotorhinolaryngologicalotorhinolaryngologistsovercommercializationselectrophysiologicallyhexamethylenetetramineincomprehensiblenessesencephalomyocarditisesdihydroxyphenylalanineestablishmentarianismsindistinguishabilitiesmicrospectrophotometercounterinterpretationsmicrospectrophotometryPhrases (923)
venezuelan monetary unitdisjunctive conjunctionlycopersicon esculentumadministrative districtadministrative divisiongilbert keith chestertongregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphusadministrative official
...View all with 22 letters...
Words (12)
electroencephalographicnonrepresentationalismsreinstitutionalizationsdeinstitutionalizationshexamethylenetetraminesintersubstitutabilitiesoverintellectualizationdichlorodifluoromethaneindistinguishablenesseshypobetalipoproteinemiamicrospectrophotometersmicrospectrophotometricPhrases (643)
gilbert and ellice islandsfamily threskiornithidaeparenthetical expressiontransient ischemic attacktribasic sodium phosphatesecond battle of el alameinposterior pituitary glandchlorpheniramine maleateto all intents and purposesarchibald percival wavell
...View all with 23 letters...
Words (12)
microgramma-piloselloideslaryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyintercomprehensibilitiesphosphatidylethanolamineelectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (501)
carnegie mellon universityprofessional organisationprofessional organizationlouis seymour bazett leakeylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwin
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (352)
count ferdinand von zeppelinunited states secret servicecluster of differentiation 4myroxylon balsamum pereiraecosmic microwave backgroundbureau of justice assistanceigor fyodorovich stravinskybureau of justice statisticsmiguel de cervantes saavedradiamond wedding anniversary
...View all with 25 letters...
Phrases (252)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidx-linked dominant inheritanceconfederate states of americabacon-lettuce-tomato sandwichsir sarvepalli radhakrishnannational institutes of health
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (177)
business environment analysispartial differential equationamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinelectromechanical transduceroffice of management and budgetsolenostemon scutellarioides
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (158)
revolutionary people's struggleinterstate commerce commissionaleksandr feodorovich kerenskybusiness process reengineeringbureau of engraving and printingephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerstrategic arms limitation talks
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (113)
business environmental analysisbusiness interruption insurancesecond council of constantinoplealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers association
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (84)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovamusculus sternocleidomastoideusreduced instruction set computingalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalityself-report personality inventorybachelor of arts in library science
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (81)
united states public health servicegreat smoky mountains national parkbureau of intelligence and researchsecond epistle to the thessaloniansfreedom from involuntary servitudemarie louise elisabeth vigee-lebrundigital communications technology2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdi
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (52)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasehierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organization
...View all with 32 letters...
Phrases (48)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languageepistle of paul the apostle to philemoncongress of industrial organizationslycopersicon esculentum cerasiforme
...View all with 33 letters...
Phrases (40)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicus
...View all with 34 letters...
Phrases (32)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation party
...View all with 35 letters...
Phrases (26)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishment
...View all with 36 letters...
Phrases (26)
severe combined immunodeficiency diseasesisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyunited states declaration of independenceal-jama'a al-islamiyyah al-muqatilah bi-libyatheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime prevention
...View all with 37 letters...
Phrases (13)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban development
...View all with 38 letters...
Phrases (14)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestine
...View all with 39 letters...
Phrases (13)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security network
...View all with 40 letters...
Phrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (9)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (7)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
