Words Containing: HI
(In Exact Order)
There are 11,265 words,
3,444 phrases and
9 abbr's with
HI in.
Best Scoring Words With: HI
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| whizzy | 6 | 33 | adjectiveadj | |||||
adjective • Nifty; impressive, often in a superficial or showy way. | ||||||||
| schizzy | 7 | 33 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| whizzed | 7 | 32 | verbv | |||||
noun • someone who is dazzlingly skilled in any field verb • make a soft swishing sound • move along very quickly | ||||||||
| whizzer | 7 | 31 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| whizzes | 7 | 31 | verb, adverb, nounv, adv, n | |||||
noun • A whirring or hissing sound (as above). • Someone who is remarkably skilled at something. • (especially with the verb "take") An act of urination. • Amphetamine. • (with "the") Pickpocketing. verb • To make a whirring or hissing sound, similar to that of an object speeding through the air. • To rush or move swiftly with such a sound. • To throw or spin rapidly. • To urinate. | ||||||||
| whizz | 5 | 29 | verb, nounv, n | |||||
noun • someone who is dazzlingly skilled in any field verb • make a soft swishing sound • move along very quickly | ||||||||
| muzhiks | 7 | 25 | nounn | |||||
noun • a Russian peasant (especially prior to 1917) | ||||||||
| chintzy | 7 | 24 | adjectiveadj | |||||
adjective satellite • of very poor quality; flimsy • embarrassingly stingy | ||||||||
| muzhik | 6 | 24 | nounn | |||||
noun • a Russian peasant (especially prior to 1917) | ||||||||
| hijacks | 7 | 23 | verb, nounv, n | |||||
noun • seizure of a vehicle in transit either to rob it or divert it to an alternate destination verb • take arbitrarily or by force • seize control of | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (399)
thingsbehindwithinhidinghigherhiddenthirtyhighlyphilipshieldwhiskyawhilethirstgandhihiringwhitesethicschillyhikinghippiethingywhilstachingorchidkimchihijackhitmanshivergothicchillihitterhinderuphillchiseltaichi
...View all with 6 letters...
Phrases (13)
hip padt hingehike uptai chit'ai chichip atchip incash inj. j. hillin this
...View all with 6 letters...
Words (866)
nothinghimselfhistorymachinechickenchinesehittingvehiclefishingfashionpushingchicagowhistlethirstyhighwayachievewashingthievesshiningwhiskeyworshippsychicwhiningwhisperrushingwishingbathingexhibithideousdolphinhissingcynthiachimneyhideoutthinner
...View all with 7 letters...
Phrases (54)
t. h. whitebase hitthe hilltax hikehit it upfly highe. b. whiteshine atshine uphind end
...View all with 7 letters...
Words (1367)
anythingthinkingchildrenlaughingwatchingteachingtouchinghighnesssunshinecatchingcoughingclothingreachingachievedthirteencrashingchildishwhirringmorphinemarchinghistoricbuddhistmatchingshipmentshippingsmashingmichiganmischiefcoachingflashingcrushinglordshipdownhillarchiveshardship
...View all with 8 letters...
Phrases (78)
white antel qahirahigh signhigh spothigh windhigh wirenew delhiin hidingegg whitewhite lie
...View all with 8 letters...
Words (1667)
somethingbreathingchildhoodsearchingmeanwhilefinishingfashionedarchitectwhistlinghilariousspaceshipmachineryhiroshimapunishingwhicheverswitchingwhisperedchurchillpreachingownershipshiveringlaunchinghighlighthitchcockfranchiseanarchisthistorianwhinnyinghimalayasthrashinghealthiersplashingchihuahuaravishingwhitewood
...View all with 9 letters...
Phrases (143)
high pitchhigh pointbean aphidby machineaphid lionwhite beerhigh stylehip pocketsmall shipto the hilt
...View all with 9 letters...
Words (1627)
everythingfriendshipwashingtonwhisperingphilosophyexhibitionscreechinghistoricalleadershippublishingscratchingworthwhileprohibitedrefreshingmembershipwindshieldstretchinggrandchildworshippedcensorshipinternshipchildbirthfellowshipsympathizepsychiatrychimpanzeeannihilategeographicbattleshiprhinocerossweatshirtdealershipsunbathingrothschildhispaniola
...View all with 10 letters...
Phrases (203)
hindu deityhigh reliefhigh statuswhite camasthin personwhizz alongapple aphidsun bathingbreed's hillelizabeth i
...View all with 10 letters...
Words (1562)
approachingscholarshippsychiatricachievementphilosopherpartnershipastonishingfashionablemischievousphilippinesprehistoriccitizenshipunthinkablenothingnessprohibitionannihilateddemographichitchhikingsponsorshiphibernationdiminishingflourishingdemolishinghighlightedarchipelagomachiavelliholographicmasochisticworkmanshipfurnishingsfashionablyhibernatingbodhisattvaphilandererhippocratic
...View all with 11 letters...
Phrases (270)
high profiletribal chiefhigh qualityflower childbreathing ingreat schismwalt whitmansurface shiphigh spiritshigh treason
...View all with 11 letters...
Words (1256)
relationshipchampionshippsychiatristphiladelphiaarchitecturedictatorshiphandkerchiefcatastrophicphotographicpornographichistoricallyannihilationexhilaratingbloodthirstybrainwashingphilharmonicpsychopathicchildishnessguardianshipgeographicalchiropractorhippopotamusmarksmanshiphieroglyphicamphitheaterhierarchicalrefreshinglyphilosophizeexhilarationphilanthropyhighlightingchiropracticwhippoorwillbiographicalfreethinking
...View all with 12 letters...
Phrases (248)
lake michiganisamu noguchigenus blighiagenus anhingaspace vehiclecaptain hicksstar sapphirechinese aniseachille rattimount whitney
...View all with 12 letters...
Words (930)
sophisticatedgrandchildrenphilosophicalschizophreniaschizophreniccompanionshiparchitecturalswordsmanshipcraftsmanshiphieroglyphicslaughingstocksportsmanshipexhibitionistastonishinglyhyperhidrosisphilanthropicextinguishingantihistaminewhithersoeverunfashionableoceanographicprofessorshipexhibitionismunderachieverneurosyphilismachiavellianhertfordshireunflinchinglycustodianshiphorsewhippingbronchiolitissadomasochisttopographicaltypographicalrelinquishing
...View all with 13 letters...
Phrases (298)
harvey cushingpaul hindemithwhite asbestosdelphic oraclegenus struthiowhite backlashphillips screwbitter hickorybreathing timemachine gunner
...View all with 13 letters...
Words (596)
sophisticationapprenticeshipdistinguishingphilanthropistgeographicallyschoolchildrenphilosophizingwhippersnappertelepathicallyschoolteachingunderachievingmephistophelesworcestershirespectrographicextravehiculardermatographicchickenheartedtachistoscopicheadmastershipdisenfranchisehistoplasmosisunthinkabilitybiographicallycartographicalphilosophisingambassadorshiphistoriographyhippopotamusesnewsworthinesspraiseworthilyautobiographicarchiepiscopalarchitectonicslyophilizationrhinencephalon
...View all with 14 letters...
Phrases (291)
amphibole grouppaleolithic agebreathing placenoachian delugebreathing spacebreathing spellto a higher placewhite blood cellmyrrhis odoratahigh technology
...View all with 14 letters...
Words (376)
unsophisticateddisenfranchisedphilosophicallyschistosomiasissadomasochisticcinematographicanthropomorphicgloucestershireenfranchisementtrustworthinessmischievousnessgynandromorphicarchitecturallydistributorshipdemographicallyneuropsychiatrypsychiatricallyexhibitionisticamphitheatricalconnoisseurshipchromatographicblameworthinessnonpartisanshipbiogeographicalbibliographicalechinodermatousmetallographiesnonachievementscorticotrophinsarteriographiesanthroposophiesphysiographicalfashionablenessmethylxanthinesdithiocarbamate
...View all with 15 letters...
Phrases (308)
high renaissancedialysis machineswahili languagenewton's third lawjacques lipchitzsecond childhoodsandwich islandshigh temperaturedashiell hammettfamily lophiidae
...View all with 15 letters...
Words (143)
autobiographicalcatastrophicallyentrepreneurshiprhinosporidiosisanthropomorphismphotographicallyanthropomorphiseanthropomorphizeunderachievementacquaintanceshipneuropsychiatricnorthamptonshireradioautographicpornographicallyantistrophicallydisenfranchisingradiographicallypraiseworthinesscommissionershipnonpartisanshipsnonphilosophicalmachiavellianismatrichornithidaeroentgenographicfashionabilitiesnonpsychiatristsfeatherstitchingarchiepiscopallyarchiepiscopatesleukodystrophiesrechoreographingunsophisticationiconographicallystadtholdershipsstenographically
...View all with 16 letters...
Phrases (283)
delphinium ajacisphotographic filmbattle of philippigreat wall of chinawinston churchillachillea ptarmicatopographic pointmephitis macrourarendering machinegeorge washington
...View all with 16 letters...
Words (87)
philanthropicallyinterrelationshipradioautographiesantischizophreniaantischizophreniccommissionershipsdisfranchisementsradiotelegraphiescrashworthinessesfashionablenessesarchitectonicallylexicographicallyunsophisticationsphilosophicalnesscrystallographiesmachine-accessiblemachine-controlledlymphadenopathieslymphangiographicnucleophilicitiesautoradiographiesoceanographicallythiodiphenylamineechocardiographicbibliographicallychromatographicalxeroradiographieszoogeographicallyacquaintanceshipsbiostratigraphiesptilonorhynchidaeorthopsychiatriesorthopsychiatristblameworthinessestrustworthinesses
...View all with 17 letters...
Phrases (282)
capital of ethiopiakatsushika hokusaikiswahili languageophiophagus hannahlebanese hizballahshipwreck survivorhashimoto's diseaseinterstate highwayarchibald macleishamphiprion percula
...View all with 17 letters...
Words (45)
anthropomorphizingdisenfranchisementcreditworthinessesrechromatographiesrechromatographingastrophotographiesstereophotographiclymphangiographiespraiseworthinessesstoichiometricallyautobiographicallytrichlormethiazidemacrophotographiesechocardiographieshydroflumethiazidephonocardiographicorthopsychiatristsoscillographicallyspectrographicallybloodthirstinessesneuropsychiatristselectromyographieshandcraftsmanshipsmetallographicallyhistocompatibilityelectrophilicitieshemoglobinopathiesangiocardiographicultrasophisticatedphotolithographiesphotolithographinginterrelationshipsrhinolaryngologistphotomicrographiessupersophisticated
...View all with 18 letters...
Phrases (225)
hindu calendar monthwashington monumentgenus struthiomimustuamotu archipelagohindustani languagemoschus moschiferusclass schizomycetesread-only memory chipfamily trichechidaenational censorship
...View all with 18 letters...
Words (25)
hydrochlorothiazidecinematographicallydisenfranchisementsotorhinolaryngologystereophotographiesimmunohistochemicalphenylthiocarbamidechromatographicallyphonocardiographiesthird-dimensionalityelectrophotographicangiocardiographiesphotofluorographiesanthropomorphicallyhistopathologicallyhistoriographicallypseudosophisticatedchromolithographieschromolithographingphytogeographicallyexhibitionisticallyunfashionablenessespaleogeographicallyschizosaccharomycespolychromatophiliasPhrases (175)
theodore harold whitedivision schizophytabattle of saint-mihielcaesalpinia echinatahundred-and-thirtiethteaching certificatechinese monetary unitgenus branchiobdellauniversity of chicagosubfamily mephitinae
...View all with 19 letters...
Words (23)
anthropomorphizationsemiautobiographicalspectroheliographiespolyphiloprogenitivecrystallographicallyphenylthiocarbamidesphiloprogenitivenessneuropsychiatricallycontradistinguishingadrenocorticotrophicphotoautotrophicallyadrenocorticotrophinelectrooculographieshistoincompatibilityelectrophotographieselectroretinographicimmunohistochemistryhistocompatibilitiesroentgenographicallypseudosophisticationhydrochlorothiazidesplethysmographicallyelectrocardiographicPhrases (142)
suborder strepsirhiniblack-capped chickadeewyethia amplexicaulisphotographic emulsionfamily trachipteridaebusiness relationshipamphitheatrum flaviumvena brachiocephalicafriendly relationshipindochinese peninsula
...View all with 20 letters...
Words (9)
otorhinolaryngologistelectrocardiographiesadrenocorticotrophinsotorhinolaryngologieselectromyographicallyelectroretinographiesanthropomorphizationsphotolithographicallypseudosophisticationsPhrases (111)
cercopithecus aethiopsphilosophical doctrinearchitectural ornamentbyzantine architecturezonotrichia albicolliscapital of new hampshirechemotrophic autotrophchionanthus virginicusfamily rhinotermitidaesamuel dashiell hammett
...View all with 21 letters...
Words (4)
immunohistochemistriesphiloprogenitivenessesotorhinolaryngologicalotorhinolaryngologistsPhrases (99)
high-density lipoproteinmusculus triceps brachiipartnership certificatearistolochia clematitisgreco-roman architecturefamily branchiostomidaeamelanchier bartramianametallographic specimenromanesque architecturedepartment of philosophy
...View all with 22 letters...
Words (1)
electroencephalographicPhrases (48)
family threskiornithidaearchibald percival wavellhippoglossus stenolepsisaristolochia serpentariathiopentobarbital sodiumanastatica hierochunticabangladeshi monetary unitdorothy rothschild parkertyrosine kinase inhibitorcapital of the philippines
...View all with 23 letters...
Words (4)
laryngotracheobronchitiselectrocardiographicallyelectroencephalographiesschizosaccharomycetaceaePhrases (44)
argyroxiphium sandwicensebattle of the philippine seahippoglossus hippoglossusgioacchino antonio rossiniexistentialist philosophyhaematoxylum campechianumvehicle-borne transmissionhigh-definition televisiongeorge washington goethalsarchitectural engineering
...View all with 24 letters...
Phrases (32)
proprietorship certificatehierarchical data structureprairie white-fringed orchidprairie white-fringed orchiscanadian arctic archipelagogasterophilus intestinalisleboyer method of childbirthmachine readable dictionarymusculus sphincter pupillaemusculus sphincter urethrae
...View all with 25 letters...
Phrases (20)
short-spurred fragrant orchidalternanthera philoxeroidesjames abbott mcneill whistleremployee stock ownership planunited nations children's fundbooker taliaferro washingtonclement philibert leo delibeschinese communist revolutioncircumflex artery of the thighpouteria campechiana nervosa
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (13)
adrenocorticotrophic hormonephilippus aureolus paracelsusambrogio damiano achille rattidianthus chinensis heddewigiireciprocal-inhibition therapyhippoglossoides platessoidesdactylorhiza maculata fuchsiipseudohypertrophic dystrophymodified harvard architectureamyotrophic lateral sclerosis
...View all with 27 letters...
Phrases (16)
ephippiorhynchus senegalensisgallinula chloropus cachinnansdistinguishing characteristicthird council of constantinoplecercopithecus aethiops sabaeusamerican staffordshire terriersingle nucleotide polymorphismmusculus sphincter ani externusmusculus sphincter ani internuscentral intelligence machinery
...View all with 28 letters...
Phrases (1)
musculus sphincter ductus pancreatici
