Words Containing: H,Y,S,I
(In Any Order)
There are 4,103 words,
2,114 phrases and
0 abbr's with
H,Y,S,I in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
schizzy | 7 | 33 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
schizy | 6 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
squishy | 7 | 22 | adjectiveadj | |||||
adjective satellite • easily squashed; resembling a sponge in having soft porous texture and compressibility | ||||||||
zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
pixyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
whiskey | 7 | 20 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
sixthly | 7 | 20 | adverbadv | |||||
adverb • in the sixth place | ||||||||
psychic | 7 | 19 | nounn | |||||
noun • a person apparently sensitive to things beyond the natural range of perception adjective satellite • affecting or influenced by the human mind • outside the sphere of physical science | ||||||||
whisky | 6 | 19 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (106)
historythirstywhiskeyphysicspsychicstylishyiddishchristysquishyhastilyfisheryyeshivashrimpyshakilyshiverygrayishkitschypythiasshrillyscythiashipwaysylphidsnitchybabyishgreyishhosieryfisheyeshriekysightlywhimseyshowilyshinglysylphicshinilythistly
...View all with 7 letters...
Phrases (3)
may fishwhisk byfish fryWords (217)
physicalslightlyeyesightsyphilishypnosishysteriachastityskylightladyshipshipyardphysiqueladyfishcrayfishhystericsisyphusasphyxialavishlypsychingyoungishphysaliascythianboyishlysunshinyshabbilyhobbyistcushionyrubbishyimpishlykyphosisfortyishdandyishgarishlyrakishlyslitheryshimmery
...View all with 8 letters...
Phrases (6)
by rightsby incheswill haysbony fishshift keyday shiftWords (399)
chemistrypsychoticphysiciansynthetichairstylejellyfishphysicisthypocrisyhimalayaspsychosishostilityyorkshiredaylightsfoolishlyhypnotisthystericssynthesisshimmyingunsightlyselfishlyhypnotismhairsprayhygienistsymphonichideouslyhemolysisheinouslychrysalissprightlyyellowishhypnotisecharybdishellishlystylishlysophistry
...View all with 9 letters...
Phrases (16)
high stylehair stylesay hey kidyoung fishhair spraywill h. hayshyssop oilgipsy moththe skinnypolly fish
...View all with 9 letters...
Words (485)
philosophyphysicallyhystericalhypothesissympathizepsychiatryhydraulicsphysiologystealthilydishonestyshockinglyhieronymusstrychninescathinglysympathiseprehistoryfreakishlysynthesizesheepishlyhypnotisedasphyxiateecchymosisfeverishlystraightlydisharmonydevilishlychildishlysyphiliticsmashinglysociopathyfiendishlysynthesisemetaphysichypersonicpolytheism
...View all with 10 letters...
Phrases (32)
spanish flybasil thymeholy spirithoney crispwhite daisyos hyoideumdummy whistchinese yamchalcis flyenglish ivy
...View all with 10 letters...
Words (574)
psychiatrichospitalitysympatheticpsychedelictchaikovskysynchronizesynthesizermetaphysicsfashionablybaryshnikovhypospadiashydroponicssynesthesiasynthesizedasphyxiatedsympathizerhairstylistsphericallyphysicalitypsychicallyphysiognomyrhinoplastyhilariouslypsychedeliadishonestlygeophysicalbiophysicalmonkeyshinehypogastricsycophantichypoplasticxylophonisthypotensivesynchronisesympathiser
...View all with 11 letters...
Phrases (50)
mighty mousesensory hairanise hyssopwhiskey neatwhiskey soursylvia plathwhistle buoyship's galleyhigh societysnowy orchid
...View all with 11 letters...
Words (593)
psychiatristpsychologistchristianitystraightawaysynchronizedhistoricallybloodthirstymetaphysicalpsychopathichystericallyasphyxiationbiochemistrybiosynthesishypertensionposthypnoticrefreshinglyastrophysicshypertensivepyrotechnicsharmoniouslypsychotropicsynchronisedpraiseworthypsychosocialpsychoactivephysiologisthypothesizedsuperhighwayexhaustivelydishonorablygeophysicistpsychometrichypogonadismstylographichypnotisable
...View all with 12 letters...
Phrases (60)
shaking palsychinese deityphantasy lifechristmas daystring theorymass hysteriabirthday suitbobby fischerphysical bodysir fred hoyle
...View all with 12 letters...
Words (502)
psychologicalhomosexualityhieroglyphicsphysiologicalpsychosomaticphysiotherapyastonishinglyhyperhidrosisunsympatheticaestheticallycholecystitisneurosyphilissynchronicityantipsychoticsynchronisingstaphylococciichthyologistsyntheticallysynchronizingpsychophysicsphysostigminehypothesisingsyphilizationlymphoblastichydrodynamicsrhapsodicallyhydrosulphidenightmarishlysynchronisticadmonishinglypsychokinetichypothesizingunfashionablyastrophysicalmischievously
...View all with 13 letters...
Phrases (98)
harvey cushingel iskandriyahsphyrna tiburomexican hyssopthree kings' daydiodon hystrixmusical rhythmmyles standishaythya affinishenry steinway
...View all with 13 letters...
Words (442)
psychoanalysishypersensitivephotosynthesisastrophysicistthermodynamicspsychoanalyticchemosynthesispsychoneuroticmetaphysicallymetempsychosisscholasticallynarcosynthesismicrochemistrypsychodynamicsunsynchronizedhypothyroidismpyelonephritisdemythologisedpsychoneurosisphotosynthetichydrotherapistchemosynthetichydrocortisoneanesthesiologyhistoriographyunhesitatinglypraiseworthilystretchabilitycomprehensiblythyroglobulinsthyrotoxicosesgeohydrologistheterozygosityaminophyllineshypermasculine
...View all with 14 letters...
Phrases (121)
myrrhis odoratayellowish brownbusman's holidaysymphonic musicblended whiskeychinese parsleychristopher frygenus nymphicushenry cavendishsouth yorkshire
...View all with 14 letters...
Words (335)
psychologicallypsychotherapistsynchronizationanaesthesiologyphysiologicallyphilosophicallyphysiotherapistheterosexualitysympathomimeticpsychobiologistsynchronisationsuccinylcholineneurophysiologystereochemistryphotosynthesizesympatheticallyeuphemisticallyneuropsychiatrypsychiatricallycomprehensivelyimperishabilitykinestheticallyadenohypophysishypersensitizedneurohypophysispsychophysicistthyroidectomiespsychedelicallyphysiographicalmethylxanthinespsychoanalyzingpolysaccharidesastrophysicistsdisenchantinglypsychohistorian
...View all with 15 letters...
Phrases (165)
helen wills moodydialysis machinesystem of weightsjohn quincy adamspsychotic beliefsodium hydroxidehyoscyamus nigerspiny-headed wormarachis hypogaeajemaah islamiyah
...View all with 15 letters...
Words (152)
enthusiasticallyincomprehensiblycatastrophicallypsychoanalyticalpsychophysiologyerythroblastosisthermostaticallypsychobiologicalelectrochemistryhypersensitivityparapsychologistneuropsychiatrichypersalivationsinextinguishablyantistrophicallyspondylarthritishypersensitizinghypersexualitiesinexhaustibilitythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparapsychologieshypersusceptibleparasympatheticshyperthyroidismshyperviscositieshypervitaminoseshypocoristicallynonpsychiatristshypophysectomiesnonpsychologicalthyrocalcitoninspathophysiologic
...View all with 16 letters...
Phrases (172)
christian huygenschemical analysisnevil shute norwaymechanical systemschool dictionarypharyngeal tonsilrheims-douay biblecichorium intybusreligious holidayelwyn brooks white
...View all with 16 letters...
Words (77)
straightforwardlyneurophysiologistpsycholinguisticspsychotherapeutichyperreactivitiesphysiotherapeuticspondylolisthesishyperstimulationsparapsychologistshyperventilationshypnotizabilitiesthrombocytopeniashypophysectomizespathophysiologieshyposensitizationhypophysectomisedhypophysectomizedencephalomyelitiscrystallographieslymphadenopathiescyclophosphamidescytotechnologistsphenylethylaminestransthoracicallydehydrochlorinaseorthopsychiatriestriiodothyroninesorthopsychiatristtriphenylmethanesneurophysiologiesgynandromorphismsneuropsychiatriesneuropsychiatristneuropsychologiesneuropsychologist
...View all with 17 letters...
Phrases (189)
division bryophytasalvia leucophyllainterstate highwaysubphylum craniatatheological systemantipsychotic drugprimary censorshipcalycanthus familypetasites hybridustypha angustifolia
...View all with 17 letters...
Words (75)
characteristicallypsychopathologicalhyperaldosteronismsociopsychologicalneuropsychologicalhypersensitivenesshypersensitivitieshypersensitizationspectroheliographynoncomprehensivelypsychotherapeuticssphygmomanometrieshypoparathyroidismhypophysectomizingpathophysiologicalhyposensitizationslaryngopharyngitislipopolysaccharidepostpsychoanalytictriphosphopyridinelymphangiographiesstoichiometricallypteridospermaphytadiethylstilbestroldistinguishabilitymucopolysaccharidehypercholesteremiadehydrochlorinasesdehydrochlorinatestrichloroethylenesorthopsychiatristsoscillographicallyspectrographicallyaerothermodynamicsneurophysiologists
...View all with 18 letters...
Phrases (188)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyclass schizomycetesantipsychotic agentgenus chamaecytisusshort-term liabilityhypostasis of christ
...View all with 18 letters...
Words (45)
hyperparathyroidismpsychophysiologicalhypersensitizationshypersusceptibilityparathyroidectomieshypoparathyroidismsmucopolysaccharideslipopolysaccharidescytopathogenicitiesimmunocytochemistrydiethylstilbesteroldiethylstilboestrolphenomenalisticallyphosphatidylcholinechromoblastomycosisthird-dimensionalityhysterosalpingogramthree-dimensionalitymethylprednisoloneselectrophysiologieselectrophysiologistincomprehensibilityencephalomyelitideshistopathologicallyhistoriographicallydihydrostreptomycinhydrometeorologistsparasympathomimeticpsychopharmacologicdiethylcarbamazinesdiethylstilbestrolsphytohemagglutininshyperconcentrationspsychophysiologiststetramethyldiarsine
...View all with 19 letters...
Phrases (188)
building supply housejohn millington syngehydrastis canadensisgiles lytton stracheydivision schizophytagenus symphoricarposavogadro's hypothesiscalycanthus floriduschinese monetary unitbritish capacity unit
...View all with 19 letters...
Words (36)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyhypersensitivenesseslipochondrodystrophycrystallographicallyhyperadrenocorticismindistinguishabilitylymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicshistoincompatibilityelectrophysiologicalelectrophysiologistsimmunohistochemistryencephalomyocarditisphotophosphorylationhydrochlorothiazidespsychopathologicallypsychopharmacologiespsychopharmacologisthypercholesterolemichypercoagulabilitieshyperconsciousnessesdimethylnitrosaminesheterobasidiomycetesplethysmographically
...View all with 20 letters...
Phrases (158)
yellow-shafted flickerwyethia amplexicaulisdivision tracheophytabalance sheet analysisdianthus caryophyllusmechanically skillfulmilton snavely hersheyfriendly relationshipsouth american countryclaude achille debussy
...View all with 20 letters...
Words (13)
psychopharmacologicalotorhinolaryngologisthypersusceptibilitiesimmunocytochemistriesmucopolysaccharidosisacetylcholinesterasesotorhinolaryngologiesphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallytetrahydrocannabinolsPhrases (133)
igor ivanovich sikorskyaleksandr solzhenitsynhelichrysum bracteatumparty to the transactionstrawberry haemangiomaarctostaphylos uva-ursiptolemy ii philadelphushenry hobson richardsonagricultural chemistryspeech intelligibility
...View all with 21 letters...
Words (6)
spectrophotometricallyintercomprehensibilityotorhinolaryngologistselectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (119)
haliaeetus leucorhyphusaleksandr i. solzhenitsynsodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroidesfamily branchiostomidaeatmospheric electricitysphyrapicus varius ruberjohns hopkins university
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (89)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphyta
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (70)
argyroxiphium sandwicensedivision heterokontophytaprimary sex characteristicdistinguished flying crossexistentialist philosophytechnology administrationhypersensitivity reactionmohorovicic discontinuitysir charles leonard woolleychrysosplenium americanum
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (53)
igor fyodorovich stravinskysymphoricarpos orbiculatusmodest petrovich mussorgskyedmund john millington syngepolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidessir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (40)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Phrases (37)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (28)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoy
...View all with 28 letters...
Phrases (14)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromehenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsfamily schizosaccharomycetaceaeprovisional irish republican army
...View all with 30 letters...
Phrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (8)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitisamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn