Words Containing: H,S,A,Y
(In Any Order)
There are 3,465 words,
2,404 phrases and
0 abbr's with
H,S,A,Y in.
Best Scoring Words With: H,S,A,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
asphyxy | 7 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
squashy | 7 | 22 | adjectiveadj | |||||
adjective satellite • like a pulp or overripe; not having stiffness • (of soil) soft and watery • easily squashed; resembling a sponge in having soft porous texture and compressibility | ||||||||
zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hyraxes | 7 | 20 | nounn | |||||
noun • any of several small ungulate mammals of Africa and Asia with rodent-like incisors and feet with hooflike toes | ||||||||
whydahs | 7 | 20 | nounn | |||||
noun • mostly black African weaverbird | ||||||||
hawkeys | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
yashmak | 7 | 19 | nounn | |||||
noun • the face veil worn by Muslim women | ||||||||
fishway | 7 | 19 | nounn | |||||
noun • A structure built on or around dams or locks to facilitate the migration of fish. | ||||||||
bashlyk | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (97)
ashtraysharplyghastlyhearsayharshlyeyelashhastilyshadowyshapelyyeshivashakilyswarthygrayishsplashyeyewashhayseedpythiaswashdaystarchysquashyscythiashipwaybabyishbrashlyasthenyyashmacyashmakchlamyshushabyhryvnashymnalshyraxesbypathsfishwayshamoys
...View all with 7 letters...
Phrases (3)
dry washmay fishpay cashWords (186)
physicalthursdaysympathyhysteriachastityhaystackladyshipshipyardstracheyladyfishscratchystealthycrayfishrhapsodyshenyangasphyxialavishlyamethystheavysethoarselysydenhamthessalyphysaliascythianshabbilyeyeshadechastelydandyishgarishlyrakishlyphantasytoadyishyeshivahflashilystanchly
...View all with 8 letters...
Phrases (15)
shut awaysea nymphbaby shoedowny ashbush babysea hollyrush awaysegway htwill hayshold sway
...View all with 8 letters...
Words (300)
physicianhairstyleblasphemyhimalayaspantyhosedaylightsplayhouseemphysemascholarlyhairsprayhorseplaychrysalischarybdisseaworthyyachtsmanayahuascahusbandryschmaltzysycophantanywhereshesitancypsychicalaeschylusforsythiastaunchlysisypheanscyphozoadashinglydysphasiabashfullyhamadryasunshapelyslaphappyslavishlyeyeshadow
...View all with 9 letters...
Phrases (28)
ready cashheavy sparhair stylestash awayspeech daysay hey kidgenus hylathomas kydpaul heysestay fresh
...View all with 9 letters...
Words (421)
physicallyhystericalpsychopathhyperspacesympathizepsychiatryhydraulicsschoolyardsleepyheadhandsomelystealthilypythagorasscathinglysympathiselachrymosesoothsayershantytownfreakishlyplayhousesasphyxiatestraightlyschooldaysshamefullydisharmonysmashinglysociopathyharmlesslymetaphysichypoplasiamysophiliadysarthriaepiphysealepiphysialcrashinglysatyagraha
...View all with 10 letters...
Phrases (64)
moshe dayangenus khayaheavy swellspanish flygenus physahenry jameshouse partybasil thymethomas graylawyer bush
...View all with 10 letters...
Words (469)
psychiatrichospitalitysympathetictchaikovskyshamelesslymetaphysicsfashionablyhorseplayerbaryshnikovbathyspherehypospadiassynesthesiaasphyxiatedsympathizerhairstylistsphericallyschenectadyphysicalityunabashedlyphraseologypsychicallyrhinoplastyhilariouslypsychedeliageophysicalbiophysicalhypogastricsycophantichypoplasticnasopharynxunashamedlysympathiserphysiatristsympathisedpsychodrama
...View all with 11 letters...
Phrases (75)
mary shelleysensory hairlaugh softlyshy away fromdylan thomassouth by easteast by southanise hyssopthymus glandchess player
...View all with 11 letters...
Words (487)
psychiatristchristianitystraightawayhistoricallymetaphysicalpsychopathichystericallyasphyxiationhypothalamusastrophysicsharmoniouslypsychobabblebreathlesslypraiseworthythoracostomypsychosocialchrestomathypsychoactivepsychosexualerythematoushaberdasherysuperhighwayexhaustivelydishonorablybreathalyserhypogonadismasynchronousstylographichypnotisabledysmenorrheapolygraphisttracheostomyasphyxiatingsynaesthesiasympathising
...View all with 12 letters...
Phrases (92)
shaking palsyphantasy lifebarbary sheepchristmas daywatch crystalgenus halcyonarthur symonsmass hysteriaa. noam chomskyshetland pony
...View all with 12 letters...
Words (424)
psychologicalhomosexualitypsychoanalystphysiologicalpsychosomaticchrysanthemumpsychotherapyphysiotherapyastonishinglyunsympatheticaestheticallypsychoanalyzedehydrogenasesympathectomyantipsychotichydrocephalusstaphylococcisyntheticallytreacherouslypyrophosphatesyphilizationlymphoblastichydrodynamicsrhapsodicallysoutheasterlynightmarishlyadmonishinglypsychoanalysenortheasterlyunfashionablylymphosarcomaastrophysicaldishonourablyinexhaustiblysaccharomyces
...View all with 13 letters...
Phrases (115)
harvey cushingel iskandriyahshammy leathergenus nymphaeasphyrna tiburosunday clothesmexican hyssopthree kings' daygenus pyrrhulamusical rhythm
...View all with 13 letters...
Words (369)
psychoanalysisastrophysicistthermodynamicsparapsychologypsychoanalyticmetaphysicallyscholasticallynarcosynthesispsychodynamicsstaphylococcusphosphorylatedasynchronouslyplethysmographhydrotherapiststaphylococcalanesthesiologyhistoriographyunhesitatinglypraiseworthilypachydermatousstretchabilityphosphorylatesaminophyllineshypermasculinedehydrogenaseshypermetropiaspsychoanalysespsychoanalyzedpsychoanalyzesmetaphysiciansstochasticallyoystercatcherspyrimethamineshedonisticallyhyperrealistic
...View all with 14 letters...
Phrases (131)
anthony burgessmyrrhis odorataclass scyphozoablackberry bushbusman's holidaychinese parsleyjapanese cherrygenus chrysaorahenry cavendisherythema solare
...View all with 14 letters...
Words (279)
psychologicallypsychotherapistsynchronizationanaesthesiologyphysiologicallyphilosophicallyphysiotherapistheterosexualitysympathomimeticsynchronisationcrystallographypsychopathologysympatheticallyeuphemisticallyneuropsychiatrypsychiatricallyultrasonographyimperishabilitykinestheticallyadenohypophysispsychedelicallyphysiographicalmethylxanthinespsychoanalyzingpolysaccharidesastrophysicistsdisenchantinglypsychohistoriansycophanticallydishearteninglyhyperaggressivehypersalivationpsychometriciandistinguishablycyproheptadines
...View all with 15 letters...
Phrases (185)
dialysis machinemrs. humphrey wardwystan hugh audenjohn quincy adamshyoscyamus nigerspiny-headed wormscholarly personarachis hypogaeajemaah islamiyahshorthand typist
...View all with 15 letters...
Words (136)
enthusiasticallycatastrophicallypsychoanalyticalsphygmomanometererythroblastosisthermostaticallypsychobiologicalrhabdomyosarcomaparapsychologistneuropsychiatrichypersalivationsinextinguishablyantistrophicallyspondylarthritishypersexualitiesinexhaustibilitythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparapsychologiesparasympatheticsapocryphalnesseshypervitaminosessphygmomanometryhypocoristicallyglossopharyngealnonpsychiatristsarchaeoastronomynonpsychologicalthyrocalcitoninspathophysiologicmonotheisticallyhypopituitarismsarchiepiscopally
...View all with 16 letters...
Phrases (190)
christian huygensgenus crotaphytuschemical analysishypophyseal stalkacross the countrynevil shute norwaymechanical systemschool dictionarypharyngeal tonsilrheims-douay bible
...View all with 16 letters...
Words (68)
straightforwardlypsychotherapeutichyperreactivitiesphysiotherapeuticparaformaldehydeshyperstimulationsparapsychologistshyperventilationssphygmomanometershypnotizabilitiesthrombocytopeniaspathophysiologieshyposensitizationencephalomyelitiscrystallographerscrystallographieslymphadenopathiescyclophosphamidesbathythermographsphenylethylaminesstereophotographypheochromocytomastransthoracicallydehydrochlorinaseglossopharyngealsorthopsychiatriesorthopsychiatristtriphenylmethanesphosphoglyceratesgynandromorphismsneuropsychiatriesneuropsychiatristunsympatheticallymesembryanthemumsmetapsychological
...View all with 17 letters...
Phrases (221)
division bryophytasalvia leucophyllainterstate highwayclass rhodophyceaesubphylum craniatagenus symphalangustheological systemantipsychotic drugprimary censorshipcalycanthus family
...View all with 17 letters...
Words (65)
characteristicallypsychopharmacologypsychopathologicalhyperaldosteronismsociopsychologicalneuropsychologicalhypersensitizationpolymorphonuclearsspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismpathophysiologicalhyposensitizationslaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographiesstoichiometricallypteridospermaphytadistinguishabilitymucopolysaccharidehypercholesteremiasaccharomycetaceaedehydrochlorinasesdehydrochlorinatesorthopsychiatristsoscillographicallyspectrographicallyaerothermodynamicsneuropsychiatristselectromyographiesdemythologizationshistocompatibilityheavyheartednesses
...View all with 18 letters...
Phrases (225)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyclass schizomycetesantipsychotic agentgenus chamaecytisusshort-term liabilityhypostasis of christ
...View all with 18 letters...
Words (35)
hyperparathyroidismpsychophysiologicalhypersensitizationsparathyroidectomieshypoparathyroidismsmucopolysaccharideslipopolysaccharidescytopathogenicitiesphenomenalisticallyphosphatidylcholinephosphoenolpyruvatechromoblastomycosisthird-dimensionalityhysterosalpingogramthree-dimensionalitymethylcholanthrenesencephalomyelitideshistopathologicallyhistoriographicallyparasympathomimeticpsychopharmacologicdiethylcarbamazinesphytohemagglutininshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminepsychotomimeticallyhyperemotionalitiesdimethyltryptamineshyperexcitabilitiesexhibitionisticallyhyperirritabilitiesschizosaccharomycespolychromatophiliasPhrases (196)
hydrastis canadensisclass polyplacophoragiles lytton stracheydivision schizophytagenus cryptobranchusgenus symphoricarposavogadro's hypothesiscalycanthus floriduschinese monetary unitbritish capacity unit
...View all with 19 letters...
Words (34)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallycrystallographicallyhyperadrenocorticismindistinguishabilitylymphogranulomatoseslymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicshistoincompatibilityelectrophysiologicalencephalomyocarditisphotophosphorylationpseudoparenchymatoushydrochlorothiazidespsychopathologicallypsychopharmacologiespsychopharmacologisthypercoagulabilitiespalatopharyngoplastydimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsPhrases (172)
yellow-shafted flickerwyethia amplexicaulisbalaenoptera physalusdivision tracheophytabalance sheet analysisdianthus caryophyllusmechanically skillfulmilton snavely hersheyeucalyptus calophyllalophodytes cucullatus
...View all with 20 letters...
Words (12)
psychopharmacologicalotorhinolaryngologistmucopolysaccharidosisacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologiesphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallytetrahydrocannabinolsPhrases (143)
igor ivanovich sikorskyaleksandr solzhenitsynhelichrysum bracteatumparty to the transactionstrawberry haemangiomaarctostaphylos uva-ursiptolemy ii philadelphushenry hobson richardsonagricultural chemistryhans holbein the younger
...View all with 21 letters...
Words (6)
spectrophotometricallyphosphoglyceraldehydesotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesPhrases (117)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factsodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesfamily branchiostomidaeatmospheric electricitysphyrapicus varius ruberhenry engelhard steinway
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (93)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphyta
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (73)
argyroxiphium sandwicensedivision heterokontophytasubphylum cephalochordataprimary sex characteristicexistentialist philosophytechnology administrationhypersensitivity reactionhenry wadsworth longfellowsir charles leonard woolleychrysosplenium americanum
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (58)
embryonal rhabdomyosarcomaigor fyodorovich stravinskymary wollstonecraft shelleysymphoricarpos orbiculatuspolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidessir arthur stanley eddingtonandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (43)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Phrases (36)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (26)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl cellulose
...View all with 28 letters...
Phrases (14)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromemucocutaneous lymph node syndromehenri rene albert guy de maupassanttechnical analysis of stock trendsfamily schizosaccharomycetaceaeprovisional irish republican army
...View all with 30 letters...
Phrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (8)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitisamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (7)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillattention deficit hyperactivity disordersecretary of housing and urban developmentkarl friedrich hieronymus von munchhausendefense advanced research projects agencyPhrases (1)
respiratory distress syndrome of the newborn