Words Containing: H,I,L,Y
(In Any Order)
There are 3,547 words,
2,321 phrases and
0 abbr's with
H,I,L,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
hexylic | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
oxyphil | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hazily | 6 | 21 | adverb, adjectiveadv, adj | |||||
adverb • through a haze • in an indistinct way | ||||||||
sixthly | 7 | 20 | adverbadv | |||||
adverb • in the sixth place | ||||||||
thickly | 7 | 19 | adverbadv | |||||
adverb • spoken with poor articulation as if with a thick tongue • in a concentrated manner • with a thick consistency • with thickness; in a thick manner • in quick succession | ||||||||
huffily | 7 | 19 | adverb, adjectiveadv, adj | |||||
adverb • in a huffy manner | ||||||||
fifthly | 7 | 19 | ||||||
adverb • in the fifth place | ||||||||
chimbly | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
chiefly | 7 | 18 | adverb, adjectiveadv, adj | |||||
adverb • for the most part | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (104)
holidayhappilyheavilylightlytightlystylishhillaryrightlynightlythirdlyhastilyflightychieflyshakilythicklyblightyshrillywhitelyhandilythionylhyalinesylphidhardilysightlyshowilyshinglyhyaloidsylphicpithilylithelyshinilythistlylithifybushilytechily
...View all with 7 letters...
Phrases (3)
fly highholy oilh. pyloriWords (185)
physicalslightlyalmightydaylighthorriblysyphilishumilitybrightlymythicalskylightladyshipladyfishchivalryheartilylynchingdimethylhimalayalavishlymightilyblithelyphysaliacheerilyachinglyboyishlyshabbilyhungrilyknightlyhilarityhorridlynihilityimpishlygarishlyrakishlydiphenylworthily
...View all with 8 letters...
Phrases (10)
milk wheylindy hopholy writhoney oilhail maryally withwill hayshill mynacity hallholy cityWords (327)
hairstylejellyfishhimalayashostilitylabyrinthhillbillyhydraulicdaylightsfoolishlyunhappilyplaythinghurriedlychlamydiaethicallyunsightlyselfishlyhimalayanoligarchychantillyhealthilyhideouslyhemolysisheinouslychrysalissprightlyyellowishlymphatichellishlystylishlyphilologyhaltinglywealthilypsychicalhydrofoilbimonthly
...View all with 9 letters...
Phrases (16)
high stylebenny hillhair stylewhile awayelihu yaleholy grailbill haleylye hominywild thymewhite lily
...View all with 9 letters...
Words (396)
philosophyphysicallyhystericalfaithfullyrightfullyhydraulicsphysiologyinherentlychemicallystealthilyplaywrightshockinglypolyphonicneighborlyscathinglycharminglyheroicallyhabituallyfreakishlysheepishlyhydrolyticfeverishlystraightlyethnicallyhieroglyphdevilishlychildishlysyphiliticsmashinglyhauntinglyfiendishlytouchinglylaughinglyrhythmicalhyperbolic
...View all with 10 letters...
Phrases (31)
chalcid flyspanish flyhanging flyray of lightbasil thymeholy spirithemp familyjohn wyclifchalcis flyenglish ivy
...View all with 10 letters...
Words (426)
technicallyhospitalitycalligraphypsychedelicichthyologyfrightfullypolytechnicfashionablychronicallyhairstylistpolymorphicsphericallyphysicalitypsychicallyornithologyrhinoplastyhilariouslypsychedeliadishonestlygeophysicalgraphicallyhypokalemiabiophysicalhypokalemichypoplasticxylophonistthrillinglyneighbourlymethylaminefortnightlylithographyhypovolemicrighteouslypsychologicunselfishly
...View all with 11 letters...
Phrases (60)
high qualityfilthy lucrebilly grahambilly the kidalkyl halidetightly knitlamp chimneyholding yardhenry millercity of light
...View all with 11 letters...
Words (469)
psychologisthypocriticalhypotheticalhistoricallybloodthirstymetaphysicalmythologicalhystericallyhorizontallytechnicalitydelightfullypatheticallyanaphylacticrhythmicallymechanicallyperipherallyhieroglyphicincoherentlytriumphantlyrefreshinglytheophyllinehypochloriteemphaticallyphilanthropyhydrochloricharmoniouslymethodicallyprophylacticpolicyholderphylogeneticpsychosocialforthrightlyhermeticallytheatricallyhypoglycemic
...View all with 12 letters...
Phrases (78)
molly pitcherhockey clinicshaking palsyathletic typephantasy lifedwight l. moodybicycle wheelpolicy changemarilyn hornephysical body
...View all with 12 letters...
Words (415)
psychologicaltheoreticallyhomosexualityhieroglyphicsphysiologicalfrighteninglyastonishinglybiotechnologyaestheticallyhypoglycaemiccholecystitisneurosyphilishydroelectrichallucinatoryhydrochloridehydraulicallyunflinchinglytheatricalityhypercalcemiahumiliatinglystaphylococcihyperglycemicichthyologistsyntheticallytypographicalacetylcholinetheologicallysyphilizationunimpeachablylymphoblasticrhapsodicallyhydrosulphideuninhibitedlyendolymphatichypervelocity
...View all with 13 letters...
Phrases (94)
el iskandriyahbilly mitchellheavy particleedmund hillaryhenry fieldingmusical rhythmrichard leakeymyles standishfamily historyphysical goods
...View all with 13 letters...
Words (391)
hypotheticallypsychoanalysismetaphoricallyoverwhelminglymathematicallygeographicallyalphabeticallypathologicallyhyperventilatepsychoanalyticmetaphysicallytelepathicallyscholasticallyinheritabilitypyelonephritisorthopedicallyarchetypicallyunthinkabilitydemythologisedbiographicallytelephonicallyanesthesiologynymphomaniacalunhesitatinglyethnologicallypraiseworthilyhyperbolicallybrachycephaliclyophilizationempatheticallydemythologizedstretchabilitycomprehensiblythyroglobulinsmonolithically
...View all with 14 letters...
Phrases (124)
dimethyl ketonehigh technologyyellowish brownbusman's holidaytypha latifoliablended whiskeychinese parsleyoriental cherryfamily bothidaeright to liberty
...View all with 14 letters...
Words (331)
psychologicallytechnologicallyanaesthesiologyphysiologicallyphilosophicallyheterosexualitychronologicallyparentheticallypsychobiologisttherapeuticallysuccinylcholineneurophysiologymethylphenidatelogarithmicallyauthoritativelyhypochondriacalsympatheticallyarchitecturallydemographicallyheartbreakinglyeuphemisticallypsychiatricallycomprehensivelyimperishabilitykinestheticallythyrocalcitoninapproachabilityunchangeabilitypsychedelicallyalgorithmicallyhydromechanicalmerchantabilityphysiographicalmethylxanthinespsychoanalyzing
...View all with 15 letters...
Phrases (184)
helen wills moodydialysis machinepsychotic belieffamily lophiidaenational holidayjemaah islamiyahmythical monsterlymphatic vesselchicory escarolepolyphonic prose
...View all with 15 letters...
Words (159)
enthusiasticallyincomprehensiblycatastrophicallytriphenylmethanehyperintelligenthyperventilationpsychoanalyticalphylogeneticallypsychophysiologypharmaceuticallyerythroblastosisthermostaticallypsychobiologicalelectrochemistryphotographicallyparapsychologisthypersalivationsinextinguishablypornographicallythermometricallyantistrophicallyspondylarthritisradiographicallyhypersexualitiespolyphyleticallyinexhaustibilitypolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparapsychologieshypersusceptibledimethylglyoximehyperventilating
...View all with 16 letters...
Phrases (207)
hypodermic needleitalian greyhoundcapital of hungarywilliam wycherleychemical analysisalan lloyd hodgkindwight lyman moodynevil shute norwaymechanical systemschool dictionary
...View all with 16 letters...
Words (106)
straightforwardlyanthropologicallyneurophysiologistthermodynamicallyphilanthropicallypsycholinguisticscercidiphyllaceaeunexchangeabilityspondylolisthesishyperstimulationsparapsychologistshyperventilationsmonochromaticallyhypnotizabilitieshypochondriacallychlortetracyclinepathophysiologiesarchitectonicallymorphogeneticallylexicographicallyencephalomyelitiscrystallographieslymphadenopathieshyperalimentationlymphangiographiccyclophosphamidestrichloroethylenecytotechnologistspharmacologicallyoceanographicallythiodiphenylaminephenylethylaminesbibliographicallytransthoracicallynephelometrically
...View all with 17 letters...
Phrases (222)
salvia leucophyllahypoglycemic agentsubphylum craniatatheological systemfamily trochilidaefamily didelphidaecalycanthus familyrepublic of hungarytypha angustifoliapython reticulatus
...View all with 17 letters...
Words (74)
characteristicallyhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilitysociopsychologicalneuropsychologicalspectroheliographynoncomprehensivelypathophysiologicallaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographieshyperbilirubinemiaimmunocytochemicalstoichiometricallyautobiographicallydiethylmalonylureadiethylstilbestroldistinguishabilitymucopolysaccharidehypercholesteremiaphenomenologicallyhydroflumethiazideophthalmologicallygeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatestrichloroethylenesoscillographicallyspectrographicallyneurophysiologistselectromyographies
...View all with 18 letters...
Phrases (214)
family physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyclass schizomycetesread-only memory chipfamily trichechidaeshort-term liabilityfamily loranthaceaearchitectural style
...View all with 18 letters...
Words (59)
hydrochlorothiazidepsychophysiologicalcinematographicallyotorhinolaryngologyhypersusceptibilityhypolipoproteinemiaparthenogeneticallymucopolysaccharideslipopolysaccharidesdiethylstilbesteroldiethylstilboestrolbacteriochlorophyllpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistanthropocentricallyanthropomorphicallyelectroretinographyincomprehensibilitycharacterologicallycortico-hypothalamicencephalomyelitides
...View all with 19 letters...
Phrases (211)
building supply housejohn millington syngegiles lytton stracheyphytolacca americanacalycanthus floridusathyrium filix-feminahydrobates pelagicussymphytum officinalesubfamily mephitinaeprobability theorist
...View all with 19 letters...
Words (38)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolpolyphiloprogenitivelipochondrodystrophycrystallographicallyindistinguishabilityimmunocytochemicallylymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallyhistoincompatibilityiodochlorhydroxyquinelectrophysiologicalelectrophysiologistsroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationhydrochlorothiazidespsychopathologicallypsychopharmacologiesmicrophotometricallypsychopharmacologisthypercholesterolemic
...View all with 20 letters...
Phrases (201)
yellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaemarchantia polymorphabalance sheet analysisclyde william tombaughfamily dermochelyidaedianthus caryophyllusbenjamin henry latrobe
...View all with 20 letters...
Words (18)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologisthypersusceptibilitiesmucopolysaccharidosisacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (151)
aleksandr solzhenitsynhelichrysum bracteatumfamily rhinotermitidaearctostaphylos uva-ursiptolemy ii philadelphusprocaine hydrochlorideagricultural chemistryfamily myrmecophagidaespeech intelligibilityhans holbein the younger
...View all with 21 letters...
Words (8)
spectrophotometricallyintercomprehensibilityotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (129)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynmultiple mononeuropathysodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (90)
family threskiornithidaemeperidine hydrochloridecalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkerrichard brinsley sheridanhydrophyllum virginianumsir anthony philip hopkinscamptosorus rhizophyllus
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (60)
privately held corporationdistinguished flying crossfluoxetine hydrocholorideexistentialist philosophytechnology administrationhydroxyzine hydrochloridesir charles leonard woolleychrysosplenium americanumhaematoxylum campechianumoxidative phosphorylation
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (53)
symphoricarpos orbiculatusedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidescaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddingtonmichelson-morley experimentanthony charles lynton blairtympanuchus pallidicinctus
...View all with 25 letters...
Phrases (37)
employee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authorityair force research laboratorycircumflex artery of the thighrhythm method of birth control
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (31)
holy roman emperor frederick iialeksandr sergeyevich pushkinaugustus welby northmore puginthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteinhyacinthus orientalis albulusnikolai ivanovich lobachevskyatrioventricular nodal rhythmhydraulic transmission system
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (27)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoy
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (12)
aleksandr nikolayevich scriabinhydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevskycontinuity irish republican army
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (16)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidhyperbilirubinemia of the newbornhenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsfamily schizosaccharomycetaceae
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (9)
digital communications technologyprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontovulation method of family planningvladimir vladimirovich mayakovskihuygens' principle of superpositionnorth atlantic treaty organizationmary godwin wollstonecraft shelleyPhrases (11)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoattorney general of the united states
...View all with 32 letters...