Words Containing: H,E,Y,S,E
(In Any Order)
There are 1,381 words,
1,378 phrases and
0 abbr's with
H,E,Y,S,E in.
Best Scoring Words With: H,E,Y,S,E
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| heydeys | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| eyewash | 7 | 16 | nounn | |||||
noun • lotion consisting of a solution used as a cleanser for the eyes | ||||||||
| fisheye | 7 | 16 | noun, adjectiven, adj | |||||
adjective • of or relating to a fisheye lens | ||||||||
| lychees | 7 | 15 | nounn | |||||
noun • Chinese fruit having a thin brittle shell enclosing a sweet jellylike pulp and a single seed; often dried | ||||||||
| bheesty | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| cheesy | 6 | 14 | adjectiveadj | |||||
adjective satellite • of very poor quality; flimsy | ||||||||
| hayseed | 7 | 14 | noun, adjectiven, adj | |||||
noun • a person who is not very intelligent or interested in culture | ||||||||
| hoseyed | 7 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| eyelash | 7 | 13 | nounn | |||||
noun • any of the short curved hairs that grow from the edges of the eyelids | ||||||||
| shuteye | 7 | 13 | nounn | |||||
noun • informal term for sleep | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
heyseWords (61)
emphysemaanywheresspeechifyhomeynessrhymestereyeshadowpeevishlyhymenealsflysheetsoverhypesflywheelsshynesseshydrosereneophyteshemolyseshemolyzeserythemasepiphyseskeffiyehseyeshadessynthesesmesophytehoneybeesseventhlyshinneyedhoneydewsethylatesrhymelessethylenesmethylasewheyfaceshyperopescorypheesgeophyteshemocytes
...View all with 9 letters...
Phrases (6)
speech daypaul heyseh. j. eysenckhorsey setset theoryjewish ryeWords (115)
hopelesslyhyperspacesleepyheadhelplesslyhypotenusesynecdochesynthesizesheepishlyfeverishlyseychelleshypertensesynthesiseepiphysealheedlesslyhypotheseskeypunchesdehydratesrhymestersphenotypesheteronymsrehydratesaerophyteshyperbolesmesenchymeecchymosessuperheavyhyphenatesenthymemessynthetasehyphenlesssweetishlyadhesivelyentophyteshemicyclesmethylases
...View all with 10 letters...
Phrases (17)
john wesleyheavy swellwendy househenry jameshelen hayeschinese yamkeyhole sawstyle sheetenglish yewthe holy see
...View all with 10 letters...
Words (184)
psychedelicshamelesslysynthesizerhorseplayerhoneysucklebathyspheresynesthesiasynthesizedschenectadypsychedeliamonkeyshinehypotensivehypothesizeheartlesslyhyperemesishousewifelyhousewiferybreathalyseyevtushenkoyesternightsynthesiserheterodyneshypotenuseshoneyeatersdeathlesslypolychaeteswholesomelyhypsometersshapelesslylecherouslysleepyheadsbellyachersheartsomelycheerlesslyresynthesis
...View all with 11 letters...
Phrases (24)
mary shelleycherry stonechess playergenus hyaenawhiskey neatfisheye lenshockey skateshell entitytyphus feverlymph vessel
...View all with 11 letters...
Words (229)
hypertensionhysterectomyrefreshinglyhypertensivebreathlesslyhypothesizederythematoushaberdasheryexhaustivelybreathalyserweightlesslydysmenorrheasynaesthesiaestheticallystonyheartedbeseechinglyhyperintenseblithesomelyhyperkineseshyperkinesiahypothesizespsychrometerhoneysucklesmethylaminesshamefacedlyhemihydrateshypodermisesmonkeyshineshyperactivesbathyspheresspeechlesslyhyperbolizesgametophytespolyhedrosesresynthesize
...View all with 12 letters...
Phrases (43)
chinese deitybarbary sheephoneyed wordsrhesus monkeylens of the eyespeech rhythmhawkeye statesir fred hoyledame myra hessstay together
...View all with 12 letters...
Words (188)
northwesterlyaestheticallydehydrogenasetreacherouslysoutheasterlysouthwesterlynortheasterlyoystercatcherpsychogeneticspermatophytethymectomizeshyperhidrosessoftheartedlystylishnessestheophyllineshoneycreepersdysmenorrheichymenopteransforesightedlyhyperacuitiespsychrometershypertrophieshyposensitizeresynthesizedresynthesizespteridophytespsychogenesischimneypieceshymenopterousunwholesomelyhyperkinesiasheterokaryonsethylbenzeneshyperlipemiasparasyntheses
...View all with 13 letters...
Phrases (60)
holy sepulcherholy sepulchreshammy leathergenus nymphaeathree kings' daygenus physeterhouse of prayerdubose heywardrosebud cherryhenry m. stanley
...View all with 13 letters...
Words (193)
hypersensitivechemosynthesismetempsychosispyelonephritisdemythologisedchemosyntheticanesthesiologycomprehensiblybutyrophenonesheterozygosityhypermasculinedehydrogenaseshypermetropiasheterophyllousoystercatcherspyrimethamineshyperrealistichyperawarenesshypersensitizepseudepigraphydiphenylaminesspermatophytesmetempsychosesremythologizesprepsychedelicresynthesizingdryopithecineshyperesthesiasstoutheartedlyhyperimmunizeshyperkeratoseshyperkeratosishypnotherapiesbutyraldehydesheterokaryoses
...View all with 14 letters...
Phrases (66)
blended whiskeychinese parsleyjapanese cherrygenus pyrethrumhenry cavendishgenus euthynnushenry kissingererythema solareartillery shellbishop berkeley
...View all with 14 letters...
Words (142)
anaesthesiologyheterosexualitystereochemistryphotosynthesizecholecystectomyeuphemisticallycomprehensivelykinestheticallyhypersensitizedheterogeneouslythyroidectomiespsychedelicallymethylxanthinesdishearteninglyhyperaggressivecyproheptadineshypersomnolencehyperstimulatedhyperstimulatessaccharomyceteshypervigilanceshexylresorcinolhyperlipidemiasdemythologizershypermetabolismmethoxyfluraneshypermobilitieslymphadenitisesphenylbutazoneshypermodernistssympathectomiesmethylcellulosemethylmercuriesphenylthioureasphysiotherapies
...View all with 15 letters...
Phrases (105)
helen wills moodysystem of weightspsychotic beliefspiny-headed wormhoneymoon resortlymphatic vesselchicory escarolejohnny appleseeddehydrated foodsthree-day measles
...View all with 15 letters...
Words (73)
incomprehensiblysphygmomanometerelectrochemistryhypersensitivityhypersensitizinghypersexualitieshypersomnolenceshypersusceptibleapocryphalnesseshyperviscositieshypervitaminoseshypophysectomieshypophysectomiseleukodystrophieshypophysectomizestereophonicallycyclohexylaminescytophotometrieskinaestheticallycytotechnologieschytridiomycetesphenylketonuriasphenylketonuricsneurasthenicallyheavyheartednessadenohypophysealdehydrogenationsmechanochemistryneurohypophysealmegagametophytesphosphoglyceratehysterocatalepsyphosphorescentlyelectromyographsmetapsychologies
...View all with 16 letters...
Phrases (104)
nevil shute norwaymechanical systemrheims-douay biblegenus phytelephaselwyn brooks whitegenus dermochelyssouthern dewberrysuper heavyweightresearch facilityrutherford b. hayes
...View all with 16 letters...
Words (39)
psychotherapeutichyperreactivitiesphysiotherapeuticparaformaldehydesspectrophotometryhyperventilationssphygmomanometershypophysectomizeshypophysectomisedhypophysectomizedencephalomyelitislymphadenopathiesphenylethylaminesstereophotographydehydrochlorinasetriphenylmethanesneurophysiologiesphosphoglyceratesneuropsychiatriesneuropsychologiesmesembryanthemumssuperheavyweightscomprehensibilityelectrophysiologypseudoparenchymascholecystectomieshydrometallurgiesphototypesettingscounterhypothesescounterhypothesiseleutherodactylussynchronousnessesantihypertensivesdihydroxyacetonespsychosexualities
...View all with 17 letters...
Phrases (134)
gopherus polypemusinterstate highwayclass rhodophyceaetheological systempetasites hybridusgenus haematoxylongenus haematoxylumhexadecimal systemegyptian paper rushrosebay willowherb
...View all with 17 letters...
Words (37)
hyperaldosteronismhypersensitivenessmethyltestosteronehypersensitivitieshypersensitizationspectroheliographynoncomprehensivelypsychotherapeuticssphygmomanometriesperchloroethylenespteridospermaphytadiethylstilbestrolhypercholesteremiasaccharomycetaceaedehydrochlorinasesdehydrochlorinatestrichloroethylenesaerothermodynamicselectromyographiesheavyheartednessesmethylnaphthaleneselectrophysiologicmethylprednisolonehomobasidiomycetespseudoparenchymatachlortetracyclinescholecystectomizedhydroelectricitieshydrometeorologieshydrometeorologisthyperalimentationsdihydroergotamineshyperconsciousnessdimethylhydrazineshypercorrectnesses
...View all with 18 letters...
Phrases (122)
family physeteridaedame sybil thorndikelachrymal secretionclass schizomycetesgenus chamaecytisusarchitectural stylegossypium herbaceumgenus archaeopteryxrheims-douay versionallegheny mountains
...View all with 18 letters...
Words (25)
hypersensitizationshypersusceptibilityparathyroidectomiescytopathogenicitiesdiethylstilbesteroldiethylstilboestrolphenomenalisticallyphosphoenolpyruvatethree-dimensionalitymethylcholanthrenesmethylprednisoloneselectrophysiologieselectrophysiologistincomprehensibilityencephalomyelitideshydrometeorologistsdiethylcarbamazinesdiethylstilbestrolshyperconcentrationstetramethyldiarsinedimethylnitrosaminehyperemotionalitiesdimethyltryptamineshyperexcitabilitieshyperirritabilitiesPhrases (107)
giles lytton stracheychinese monetary unithydrobates pelagicussubfamily mephitinaejapanese honeysucklesecondary censorshipcapital of seychellesgerard manley hopkinslesotho monetary unitswedish monetary unit
...View all with 19 letters...
Words (17)
hypercholesterolemiaoverenthusiasticallyhypersensitivenesseshyperadrenocorticismphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasephosphoenolpyruvateselectrophysiologicalelectrophysiologistsencephalomyocarditispseudoparenchymatoushypercholesterolemichypercoagulabilitieshyperconsciousnessesdimethylnitrosaminesheterobasidiomycetesPhrases (97)
yellow-shafted flickerwyethia amplexicaulisbalaenoptera physalusbalance sheet analysismilton snavely hersheyfriendly relationshipclaude achille debussyclarence shepard day jr.henry rowe schoolcraftbahasa melayu language
...View all with 20 letters...
Words (6)
hypersusceptibilitiesimmunocytochemistriesacetylcholinesterasesphosphoglyceraldehydehypercholesterolemiaspsychotherapeuticallyPhrases (93)
aleksandr solzhenitsynhelichrysum bracteatumstrawberry haemangiomaptolemy ii philadelphusspeech intelligibilityhans holbein the youngerphylum platyhelmintheswhite-coat hypertensionwilliam holmes mcguffeybhutanese monetary unit
...View all with 21 letters...
Words (7)
spectrophotometricallyintercomprehensibilityphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (76)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the facthigh-density lipoproteinathyrium thelypteroidesatmospheric electricityhenry engelhard steinwaydoctor of sacred theologydepartment of philosophyfirst lord of the treasury
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (56)
family threskiornithidaebangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphytasearch and destroy missionchrysanthemum partheniumdepartment of the treasuryartocarpus heterophyllus
...View all with 23 letters...
Words (2)
phosphatidylethanolamineschizosaccharomycetaceaePhrases (46)
argyroxiphium sandwicensedivision heterokontophytaprimary sex characteristicexistentialist philosophyhypersensitivity reactionhenry wadsworth longfellowsir charles leonard woolleychrysosplenium americanumelectroconvulsive therapyhelen laura sumner woodbury
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (44)
mary wollstonecraft shelleymodest petrovich mussorgskyedmund john millington syngemelanerpes erythrocephalusbeggar-my-neighbour strategysir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovskysudden infant death syndromeembryonic stem-cell research
...View all with 25 letters...
Phrases (35)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandnewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authorityair force research laboratory
...View all with 26 letters...
Phrases (26)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginpull the wool over someone's eyesdeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtenstein
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (25)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngerfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl cellulosesingle nucleotide polymorphism
...View all with 28 letters...
Phrases (11)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationsecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevskyfibrocystic disease of the breast
...View all with 29 letters...
Phrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromemucocutaneous lymph node syndromehenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsfamily schizosaccharomycetaceae
...View all with 30 letters...
Phrases (11)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatetheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united states
...View all with 32 letters...
Phrases (1)
respiratory distress syndrome of the newborn
