Words Containing: H,E,A,M
(In Any Order)
There are 5,978 words,
4,991 phrases and
0 abbr's with
H,E,A,M in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
mezuzah | 7 | 30 | nounn | |||||
noun • religious texts from Deuteronomy inscribed on parchment and rolled up in a case that is attached to the doorframe of many Jewish households in accordance with Jewish law | ||||||||
hackmen | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
whammed | 7 | 18 | verbv | |||||
verb • strike hard | ||||||||
empathy | 7 | 17 | nounn | |||||
noun • understanding and entering into another's feelings | ||||||||
alchemy | 7 | 17 | nounn | |||||
noun • the way two individuals relate to each other • a pseudoscientific forerunner of chemistry in medieval times | ||||||||
chamfer | 7 | 17 | verb, nounv, n | |||||
noun • two surfaces meeting at an angle different from 90 degrees verb • cut a bevel on; shape to a bevel • cut a furrow into a columns | ||||||||
nymphae | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
mayhems | 7 | 17 | nounn | |||||
noun • the willful and unlawful crippling or mutilation of another person • violent and needless disturbance | ||||||||
champed | 7 | 17 | verbv | |||||
noun • someone who has won first place in a competition verb • chafe at the bit, like horses • chew noisily or vigorously | ||||||||
ecthyma | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (176)
michaelmachineashamedmatthewchambersmashedmessiahshermanmatchedhamstercharmedthermalmethanemacheteempathymacbethhermanncharmeralchemyrematchmarcheschimeramanholehellmanatheismhammettsmasherschmearanaheimbohemiaheadmanmachreeishmaelimpeachmenorah
...View all with 7 letters...
Phrases (4)
sea holmram homechem labmake hayWords (364)
handsomechemicalsomewhathomelandmechanicharmlesschambersmerchantfreshmanmustacheshamefulmetaphormohammedhomemadehammeredhorsemanmadhousebohemianunharmedfamishedemphasisjeremiahpamphlethalftimehandmadeshamblesearthmanhenchmancashmereinhumaneeichmannmemsahibhematomamachetescomanche
...View all with 8 letters...
Phrases (32)
heat pumpmess hallsea nymphmash beancat thymewhite manmarsh henmore thangame fishhigh beam
...View all with 8 letters...
Words (576)
champagnenightmaremeanwhilemoustacheshamelesshamburgerfishermanhumiliatemechanicsmachinerymechanismfrenchmanphenomenablasphemycheckmatehammeringfarmhouseemphasizehemingwayhampshirechameleonmisbehaveaftermathalchemistmethadonechamomileparchmentmilkshakehermitagehousemaidsqueamishshoemakermakeshiftcatechismhematuria
...View all with 9 letters...
Phrases (85)
by machinemop handlemale childsketch mapmale horsehome platehome rangewhite meatlove matchdead march
...View all with 9 letters...
Words (804)
atmospherehumiliatedhomosexualmechanicalmanchesterenthusiasmheadmasterharassmentmotherlandmelancholyphenomenalenglishmancarmichaelattachmentsympathizeweathermanhemorrhagechimpanzeedetachmentsuperhumanarithmeticgramophonechemicallymatchmakerschoolmaterheumatismhandsomelyhammerheadjackhammermisbehavedarchimedesbanishmentblasphemermethodicalmathematic
...View all with 10 letters...
Phrases (133)
white camasmoshe dayanslim chancehall of famesam shepardhatchet manshame plantminute handwoman hatercamber arch
...View all with 10 letters...
Words (874)
grandmotherachievementmathematicsmerchandisesympatheticchamberlainscaramoucheatmosphericstomachachedemographichypothermiahypermarketbiochemicalshamelesslymelancholicenchantmentblasphemousmisbehavingchambermaidmachiavellienhancementbeachcomberamphetaminemetaphysicshaemorrhagehaemorrhoidmentholatedfrenchwomanmisanthropetutankhamencharlemagnemustachioedmelancholiahousemasterathleticism
...View all with 11 letters...
Phrases (200)
beam of lightgreat schismmary shelleyline of marchearth tremoranemone fishbroom handlefemale chestfemale childmale monarch
...View all with 11 letters...
Words (842)
accomplishedmichelangelochemotherapymanslaughtermathematicalcommonwealthheadmistressmetaphysicalhousewarmingsledgehammerhemorrhagingformaldehydeastonishmentflamethrowerunfathomablemetaphoricalschoolmasterhydrothermalmechanicallyaromatherapyamphitheaterblabbermouthmalnourishedcinemathequespeechmakingemphaticallypneumothoraxmethodicallymerchandiserheartwarmingphenomenallyamphitheatremisbehaviourgamesmanshipphentolamine
...View all with 12 letters...
Phrases (243)
graham greeneplant hormonegenus anethumlake michiganbaal merodachgeorge m. cohanmount shermanprotest marchathletic gamechemical bond
...View all with 12 letters...
Words (739)
establishmentmassachusettshomosexualitymathematicianmetamorphosismerchandisingchrysanthemummagnetospherechristmastimehermaphroditepetrochemicalshamelessnessantihistaminethermonuclearunsympathetichypoglycaemichaemorrhagingmachiavelliansympathectomyunimpeachablemetamorphoseschloromethanehypercalcemiathermoplasticencephalogramthermodynamicrapprochementmouthwateringhermeneuticalunimpeachablymechanizationtransshipmentnonmechanicalendolymphaticimmunotherapy
...View all with 13 letters...
Phrases (326)
john masefieldpaul hindemithmight-have-beenpouched mammalgrain merchantmarcel duchampbreathing timehard-shell clammachine gunnerclyde tombaugh
...View all with 13 letters...
Words (615)
pharmaceuticalaccomplishmentcinematographymetaphoricallymathematicallythermodynamicsmetaphysicallyphotogrammetryunaccomplishednorthumberlandhermaphroditicdehumanizationdisenchantmentorthomoleculardermatographicheadmastershiphydropneumaticmechanicalnessplethysmographmethodologicalchlorpromazineechocardiogramoveremphasizedservomechanismmalnourishmenthippopotamusesomphaloskepsisanthropometricshamefacednessaccomplishablemonosaccharideempatheticallypachydermatousdisheartenmenthomogenization
...View all with 14 letters...
Phrases (346)
amphibole groupfisherman's lurenational anthemchemical changeboehmeria niveachristmas bellsrough-and-tumbleheating elementflight maneuverteaching method
...View all with 14 letters...
Words (423)
cinematographermethamphetaminemisapprehensionsympathomimeticlymphadenopathycinematographicenfranchisementmethylphenidateplainclothesmanchloramphenicolsympatheticallydemographicallyeuphemisticallydiphenhydramineelectrochemicalamphitheatricalimperishabilityhermaphroditismblameworthinesswarmheartednessthermoregulatorrhombencephalonbiomathematicalblasphemousnessultramarathoneraccomplishmentschemoautotrophyreestablishmentechinodermatousnonmathematicalschoolmasterishmetallographiesnonachievementschromatographeddehumanizations
...View all with 15 letters...
Phrases (427)
dialysis machinemrs. humphrey wardgenus gnaphaliumacheta assimilisacheta domesticameat thermometerhigh temperaturechemical balancehorned chameleonhyoscyamus niger
...View all with 15 letters...
Words (188)
pheochromocytomatriphenylmethanechemotherapeuticelectromyographypharmaceuticallysphygmomanometerthermostaticallyepiphenomenalismthrombocytopeniaanthropomorphiseanthropomorphizeunderachievementnorthamptonshirethermolabilitieshymenophyllaceaeradiochemistriesspectroheliogramparaformaldehydethermometricallyextrachromosomalmicrogametophytethermoplasticityhyperstimulatingthermoregulatingheterometabolismhyperstimulationthermoregulationheterometabolousthermoregulatorsthermoregulatorymachiavellianismparasympatheticsthermoremanenceshypervitaminosessphygmomanometry
...View all with 16 letters...
Phrases (446)
battle of marathonmanihot esculentabattle of monmouthdelphinium ajacisw. somerset maughamstephane mallarmewilliam wycherleychemical analysisachillea ptarmicamephitis macroura
...View all with 16 letters...
Words (104)
parathyroidectomythermodynamicallyelectromechanicaldextroamphetaminenonmathematicianspolymorphonuclearspectroheliogramsparaformaldehydesdisestablishmentshyperstimulationsthermoregulationsdisfranchisementsthermostabilitiessphygmomanometersthrombocytopeniasmammothermographymorphogeneticallyrechromatographedencephalomyelitismachine-accessiblemachine-controlledlymphadenopathieshyperalimentationcyclophosphamidesimmunohematologicthiodiphenylaminepharmacotherapiesbathythermographswarmheartednessesimmunopathologiesphenylethylaminespheochromocytomasnephelometricallydehumidificationselectrochemically
...View all with 17 letters...
Phrases (433)
heat of sublimationcompetence hearingmount kanchenjungaclomiphene citrateczech monetary unitmary mcleod bethunepast-tense morphemehypoglycemic agenthashimoto's diseasedrag through the mud
...View all with 17 letters...
Words (69)
hyperaldosteronismdisenfranchisementpolymorphonuclearsthermoplasticitiesinharmoniousnessesmonochromaticitiessphygmomanometriesarchaeoastronomiesrechromatographiesrechromatographingmuddleheadednesseslymphangiographieshyperbilirubinemiaimmunocytochemicalstoichiometricallypteridospermaphytatrichlormethiazidediethylmalonylureamacrophotographiesmucopolysaccharideimmunohematologiesimmunohematologisthypercholesteremiasaccharomycetaceaephenomenologicallyplasmodiophoraceaehydroflumethiazidepheochromocytomatachemotherapeuticalmechanochemistriesimperishablenessesneuropharmacologicphosphoglucomutaseaerothermodynamicselectromyographies
...View all with 18 letters...
Phrases (450)
hindu calendar monthwashington monumenttuamotu archipelagophotographer's modelfamily physeteridaedame sybil thorndikelachrymal secretionafghan monetary unitgeorge michael cohanmount rushmore state
...View all with 18 letters...
Words (51)
hyperparathyroidismpseudohermaphroditepneumoencephalogramcinematographicallydisenfranchisementsparathyroidectomieshypolipoproteinemiaencephalomeningitismucopolysaccharidesanarcho-collectivismmagnetohydrodynamicimmunohematologicalimmunohematologistsimmunohistochemicalphenomenalisticallyphenylthiocarbamideneuropharmacologiesneuropharmacologistphosphoglucomutaseselectromechanicallyphosphomonoesterasethird-dimensionalitymeningoencephalitichysterosalpingogramthree-dimensionalitymeningoencephalitiselectrophoretogramsmethylcholanthreneshemidemisemiquaversmakataimeshekiakiakencephalomyelitidesphenylpropanolamineradiopharmaceuticalchlorofluoromethanehydrometeorological
...View all with 19 letters...
Phrases (363)
allium schoenoprasumphytolacca americanagenus symphoricarposbattle of saint-mihielstephen michael reichmechanical advantageathyrium filix-feminachinese monetary unitold world hop hornbeambattle of the metaurus
...View all with 19 letters...
Words (31)
hypercholesterolemiaelectroencephalogramsemiautobiographicalradiopharmaceuticalsspectrophotometricalparathyroidectomizedhyperadrenocorticismlymphogranulomatosesimmunocytochemicallyphenylpropanolaminesphenylthiocarbamidespseudohermaphroditicoophorosalpingectomyneuropharmacologicalneuropharmacologistsphosphomonoesteraseshyperlipoproteinemiamagnetohydrodynamicshistocompatibilitiesencephalomyocarditischemotherapeuticallyantiestablishmentismchlorofluoromethanespseudoparenchymatouspsychopharmacologiesmicrophotometricallydimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsmischaracterizationsPhrases (318)
archeological remainshonduran monetary unitwyethia amplexicaulisabelmoschus moschatusfamily phytolaccaceaephotographic emulsionfamily trachipteridaewalther hermann nernstclyde william tombaughfamily dermochelyidae
...View all with 20 letters...
Words (10)
hypogammaglobulinemiadisestablishmentarianestablishmentarianismpseudohermaphroditismelectroencephalogramsmeningoencephalitideselectromyographicallypolyvinyl-formaldehydearenaria-melanocephalahypercholesterolemiasPhrases (273)
acrocentric chromosomesir john everett millaisabelmoschus esculentusadministrative hearinghelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumhelichrysum bracteatumanigozanthus manglesiistephen william hawking
...View all with 21 letters...
Words (7)
pentamethylenetetrazoldisestablishmentariansspectrophotometricallycarboxymethylcellulosehexamethylenetetramineencephalomyocarditisesestablishmentarianismsPhrases (218)
gregorian calendar monthschlumbergera truncatusredevelopment authorityhydrated aluminium oxidebarbara wertheim tuchmanleishmaniasis americanaherbert marshall mcluhanmultiple mononeuropathysodium tripolyphosphatebattle of the bismarck sea
...View all with 22 letters...
Words (4)
carboxymethylcelluloseshexamethylenetetraminesdichlorodifluoromethanehypobetalipoproteinemiaPhrases (153)
family threskiornithidaetransient ischemic attacktribasic sodium phosphatechlorpheniramine maleateelectromechanical deviceaugust wilhelm von hofmannkazakhstani monetary unitpharmacological medicinethiopentobarbital sodiumhenri emile benoit matisse
...View all with 23 letters...
Words (5)
hyperbetalipoproteinemiaphosphatidylethanolaminemicroelectrophoreticallydichlorodifluoromethanesschizosaccharomycetaceaePhrases (124)
basque homeland and freedompelham grenville wodehouseargyroxiphium sandwicensesubphylum cephalochordataprimary sex characteristicbattle of the spanish armadadmitri ivanovich mendeleevarthur meier schlesinger jr.commonwealth of the bahamasantiarrhythmic medication
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (82)
embryonal rhabdomyosarcomamary wollstonecraft shelleybattle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalpolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategysaddam bin hussein at-takriti
...View all with 25 letters...
Phrases (63)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housex-linked dominant inheritancebacon-lettuce-tomato sandwichadrenocorticotropic hormonejames abbott mcneill whistlerhuman immunodeficiency virusemployee stock ownership planandrei dimitrievich sakharov
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (52)
holy roman emperor frederick iielectromechanical transduceraugustus welby northmore puginfreedom from search and seizurejerusalem artichoke sunfloweradrenocorticotrophic hormonedeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonehomo sapiens neanderthalensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (46)
marcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycommission on the status of womendemocratic republic of the congofederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskydepartment of homeland securitysergei mikhailovich eisenstein
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (28)
chemical decomposition reactionfriedrich wilhelm august froebeldmitri dmitrievich shostakovichcapital of the dominican republicsao thome e principe monetary unitferdinand joseph la menthe mortonhydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonrene antoine ferchault de reaumur
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (22)
valentina vladmirovna tereshkovaethylenediaminetetraacetic acidaleksandr mikjailovich prokhorovaugust friedrich leopold weismannwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornplasma thromboplastin antecedentmucocutaneous lymph node syndromeesther hobart mcquigg slack morrishenri rene albert guy de maupassant
...View all with 30 letters...
Phrases (20)
marie louise elisabeth vigee-lebrundigital communications technologysir john frederick william herschelanicius manlius severinus boethiusprimary subtractive color for lightislamic jihad movement in palestinewernher magnus maximilian von brauncommonwealth of independent statesmaria luigi carlo zenobio cherubinirichard august carl emil erlenmeyer
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (15)
nikolai andreyevich rimski-korsakovafrican american vernacular englishdepartment of the federal governmenthierarchical classification systemstraight-line method of depreciationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateprimary subtractive colour for lightedmond louis antoine huot de goncourtoculopharyngeal muscular dystrophy
...View all with 32 letters...
Phrases (10)
characteristic root of a square matrixepistle of paul the apostle to philemonbureau of alcohol tobacco and firearmsdisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanneridiopathic thrombocytopenic purpurahimantopus himantopus leucocephalusdefense technical information centerPhrases (12)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticihermann ludwig ferdinand von helmholtzmassachusetts institute of technologyfederal home loan mortgage corporationdepartment of health and human services
...View all with 34 letters...
Phrases (8)
national baseball hall of fame and museumnational technical information servicecommunications security establishmentcomte donatien alphonse francois de sadeimmaculate conception of the virgin maryhereditary motor and sensory neuropathychristopher william bradshaw isherwoodfederal democratic republic of ethiopiaPhrases (9)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberdeclining balance method of depreciation