Words Containing: H,A,I,R
(In Any Order)
There are 10,987 words,
7,656 phrases and
0 abbr's with
H,A,I,R in.
Best Scoring Words With: H,A,I,R
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
charqui | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
rhizoma | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
khirkah | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hijrahs | 7 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hijrah | 6 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hayrick | 7 | 19 | nounn | |||||
noun • a stack of hay | ||||||||
hazier | 6 | 18 | adjectiveadj | |||||
adjective satellite • filled or abounding with fog or mist • indistinct or hazy in outline | ||||||||
whipray | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
rikshaw | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
harijan | 7 | 17 | nounn | |||||
noun • belongs to lowest social and ritual class in India | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
hairWords (284)
alrightcharliehearingcharitysharinghappierhaircutkrishnaheaviercashiergraphichillaryarchivekashmirchariotinhaleribrahimpiranhabrahminhaywirehardingkarachivarnishraleighparrishchimeraairshiphayridearchaichairpinharpingairheadtarnishwarshipcharing
...View all with 7 letters...
Phrases (11)
air holeair hornair hosethin airhair dyehair gelhair oilhire carrich manharold i
...View all with 7 letters...
Words (601)
straightbirthdaycharmingbehaviorchairmanreachingharrisonwithdrawcrashingchargingmarchingheritagediarrheaarchiveshardshiprichardscharismarickshawhysteriajeremiahgraphicsarmchairsheridanairtightshipyardsapphirestarfishchivalryeuphoriamariachihijackerhairlesshairlinehoardingheartily
...View all with 8 letters...
Phrases (54)
el qahiragill archhair ballchair carair shaftin the rawlight airsushi barwear thinal qahira
...View all with 8 letters...
Words (1077)
christmasbreathingchristiansearchingnightmareauthoritycatherinegatheringarchitectbehaviourtherapisthilarioushurricanedischargefishermanhungarianmachineryhiroshimawithdrawnpreachinghairstylebiographychevalierfranchiseanarchisthistorianauthorizebirthmarkthrashinghealthieraphroditehammeringharmonicaarthritisravishing
...View all with 9 letters...
Phrases (115)
pariah dogright awayhair drierhair dryerrain checkdirt cheaphair slidehair stylereal thingfalse hair
...View all with 9 letters...
Words (1450)
chatteringhistoricalstraightenwheelchairleadershiphystericalauthorizeddischargedrehearsingscratchingwithdrawalgrandchildwitchcraftshatteringcharitablepharmacistarchbishopchandeliertheatricalhorizontaldishwasherhereditarycarmichaelantichristfahrenheitbehavioraldistraughttriumphantbirthplacepsychiatrybirminghamrichardsoncartwrightunbirthdaygeographic
...View all with 10 letters...
Phrases (198)
shah of iranjohn napierstrike hardfacial hairhead of hairair marshalright brainchoir stallafro hairdorive gauche
...View all with 10 letters...
Words (1627)
threateningauthoritiesapproachingscholarshiphandwritingpsychiatricinheritancepartnershiphairdressermerchandisetheoreticalchamberlainbrainwashedhardworkingcalligraphyatmospherictherapeuticcharismaticdemographicwithdrawingaphrodisiachypothermiahibernationswitchboarddehydrationhorseradishcliffhangerhyperactivediaphoreticarchipelagohandwrittenchambermaidholographicoverheatingpatriarchal
...View all with 11 letters...
Phrases (281)
tribal chiefriding habitflower chaintribal sheikbreathing inrubbish heapgreat schismweather sidesurface shiphanding over
...View all with 11 letters...
Words (1646)
relationshippsychiatristarchitecturechristianitydictatorshiphandkerchiefcatastrophiccheerleadinghumanitarianhypocriticalphotographicbreathtakingstraightawayheadmistresspornographicunauthorizedhistoricallyexhilaratingbrainwashinghousewarminghemorrhagingphilharmonichairdressingarcheologisthystericallyhorizontallyapprehensionapprehensiveguardianshipgeographicalchiropractorrehabilitatedishonorablemetaphoricalcharacterize
...View all with 12 letters...
Phrases (414)
grain alcoholtribal sheikhotolith organgrain sorghumhead coveringstar sapphirerough drawingachille rattiparhelic ringkitchen range
...View all with 12 letters...
Words (1381)
grandchildrenauthorizationtheoreticallyschizophreniaarchaeologistarchitecturalautobiographyheartbreakingswordsmanshipmetamorphosischaracterizedcraftsmanshiprehabilitatedmerchandisingarcheologicalauthorisationhypochondriacsportsmanshipauthoritarianchristmastimeparaphernaliaphysiotherapyhermaphroditeauthenticatordishonourablepetrochemicalphilanthropicchateaubriandchronologicalauthoritativeorchestratingdiaphragmatichyperactivityoceanographicfeatherweight
...View all with 13 letters...
Phrases (514)
partial breachharvey cushingel iskandriyahdelphic oraclearcheozoic eongrain merchantcharm campaignbreathing timelouis the greatfrances wright
...View all with 13 letters...
Words (1104)
pharmaceuticalrehabilitationcharacteristicclaustrophobiccinematographyarchaeologicalanthropologistmetaphoricallyapprenticeshipclaustrophobiaphilanthropistgeographicallycardiomyopathyastrophysicistthermodynamicscholinesterasehyperventilateindecipherablewhippersnapperornithologicalstraightjacketrehabilitatingnarcosynthesisunderachievingnonthreateningosteoarthritisirreproachablepharmacologisthermaphroditicspectrographicinheritabilityautobiographerphantasmagoriaextravehiculardermatographic
...View all with 14 letters...
Phrases (548)
thoracic cavityamphibole groupbreathing placebreathing spacebreathing spellauf wiedersehencastle in the airsir joseph banksto a higher placemyrrhis odorata
...View all with 14 letters...
Words (841)
straightforwardcinematographerpsychotherapistsynchronizationpithecanthropusdisenfranchisedphotojournalistinterchangeablephysiotherapistanthropologicalheterosexualitymisapprehensionparthenogenesischronologicallypharmacologicalcinematographicphotojournalismanthropomorphicinterscholasticparentheticallytherapeuticallysynchronisationenfranchisementmicrophotographanticholinergiclogarithmicallychloramphenicolauthoritativelyhypochondriacalgynandromorphiccatheterizationarchitecturallynearsightednessdemographicallyheartbreakingly
...View all with 15 letters...
Phrases (663)
bitter chocolatehonduran capitalhigh renaissancecaltha palustrissir john vanbrighnewton's third lawbelgian shepherdnikolai bukharinhigh temperaturehundred-and-first
...View all with 15 letters...
Words (312)
autobiographicalcharacterizationaustralopithecuscatastrophicallytriphenylmethanehyperventilationchemotherapeuticuncharacteristicpharmaceuticallytrichotillomaniaerythroblastosisthermostaticallythrombocytopeniaanthropomorphismcharacterisationoverenthusiasticlightheartednessphotographicallyanthropomorphiseanthropomorphizeunderachievementparapsychologistauthoritarianismneuropsychiatricnorthamptonshireradioautographicthermolabilitieshypersalivationspornographicallyradiochemistriesspectroheliogramthermometricallyantistrophicallydisenfranchisingspondylarthritis
...View all with 16 letters...
Phrases (632)
italian greyhoundchelonian reptilechristian huygensphotographic filmcapital of hungarywilliam wycherleynathaniel currierochotona princepsgreat wall of chinaachillea ptarmica
...View all with 16 letters...
Words (206)
straightforwardlyanthropologicallyparathyroidectomytriskaidekaphobiathermodynamicallyphilanthropicallypsychotherapeuticelectromechanicaldextroamphetamineinterrelationshiphyperreactivitiesradioautographiesantischizophreniaantischizophrenicphysiotherapeuticcercidiphyllaceaeradiochromatogramspectroheliogramsspectroheliographkindheartednesseshyperstimulationsthermoregulationsdisfranchisementsparapsychologistsradiotelegraphiesinheritablenessesthermostabilitieshyperventilationsmonochromaticallythrombocytopeniasapproachabilitiescrashworthinesseshypochondriacallychlortetracyclinearchconservatives
...View all with 17 letters...
Phrases (690)
horizontal sectiongopherus agassiziijacqueline cochrancompetence hearingdivision bryophytacivil rights leaderclomiphene citrateczech monetary unitacherontia atroposhandicapped person
...View all with 17 letters...
Words (125)
characteristicallyanthropomorphizinghypercoagulabilityhyperaldosteronismdisenfranchisementinterchangeabilityneuropsychologicalhypersensitizationradiochromatogramsspectroheliographsspectroheliographythermoplasticitiesinharmoniousnessesdishonorablenessesfaintheartednessesmonochromaticitiespsychotherapeuticsapprehensivenessessphygmomanometriesarchaeoastronomieshypoparathyroidismanthropocentricityrechromatographiesrechromatographinglaryngopharyngitislightheartednesseslipopolysaccharideastrophotographiesstereophotographiclymphangiographiespraiseworthinesseshyperbilirubinemiaaustralopithecinesstoichiometricallyautobiographically
...View all with 18 letters...
Phrases (639)
hindu calendar monthheat of vaporisationtuamotu archipelagoheat of vaporizationfamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyedgar rice burroughsafghan monetary unit
...View all with 18 letters...
Words (91)
hyperparathyroidismhydrochlorothiazidepseudohermaphroditecinematographicallystraightforwardnessdisenfranchisementshypersensitizationsotorhinolaryngologyparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismsmucopolysaccharideslipopolysaccharidesglottochronologicalstereophotographiesresorcinolphthaleinanarcho-collectivismauthoritativenessesbacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenylthiocarbamideelectrocardiographschromatographicallyphonocardiographiesdehydrochlorinatingdehydrochlorinationchromoblastomycosisneuropharmacologiesphosphofructokinaseneuropharmacologistelectromechanicallythird-dimensionalitycontradistinguished
...View all with 19 letters...
Phrases (577)
rejoicing over the lawcivil rights activisthydrastis canadensisallium schoenoprasumtheodore harold whiteread between the linesgiles lytton stracheyphytolacca americanagenus symphoricarposhaliotis tuberculata
...View all with 19 letters...
Words (63)
uncharacteristicallyhypercholesterolemiaanthropomorphizationoverenthusiasticallytetrahydrocannabinolparadichlorobenzenessemiautobiographicalspectroheliographiesradiopharmaceuticalsspectrophotometricalparathyroidectomizedcrystallographicallyhyperadrenocorticismlymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesinterchangeabilitiesacetylcholinesterasepseudohermaphroditicoophorosalpingectomydehydrochlorinationsneuropharmacologicalphosphofructokinasesneuropharmacologistsneurophysiologicallyneuropsychiatricallycontradistinguishinghyperlipoproteinemiaadrenocorticotrophicphotoautotrophicallyadrenocorticotrophinmagnetohydrodynamicselectrooculographiesphotodisintegrations
...View all with 20 letters...
Phrases (487)
archeological remainsgilbert charles stuarthonduran monetary unityellow-shafted flickerphotographic emulsionfamily trachipteridaebusiness relationshipmarchantia polymorphadivision tracheophytahundred-and-forty-fifth
...View all with 20 letters...
Words (26)
psychopharmacologicaldisestablishmentarianotorhinolaryngologiststraightforwardnessesmucopolysaccharidosisestablishmentarianisminterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismadrenocorticotrophinsotorhinolaryngologieselectromyographicallydendrochronologicallyelectroretinographiesanthropomorphizationsphotolithographicallypolyvinyl-formaldehydeantiauthoritarianismspseudocholinesterasesarenaria-melanocephalaphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (420)
acrocentric chromosomesir john everett millaisadministrative hearingcercopithecus aethiopshelianthemum scopariumanaphalis margaritaceaigor ivanovich sikorskyaleksandr solzhenitsynanthriscus cereifoliumhelichrysum bracteatum
...View all with 21 letters...
Words (9)
disestablishmentariansspectrophotometricallyotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalanineestablishmentarianismsPhrases (339)
gregorian calendar monthhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridebarbara wertheim tuchmanleishmaniasis americanaaleksandr i. solzhenitsynviola tricolor hortensisjohn ronald reuel tolkien
...View all with 22 letters...
Words (4)
electroencephalographichexamethylenetetraminesdichlorodifluoromethanehypobetalipoproteinemiaPhrases (237)
family threskiornithidaeparenthetical expressiontransient ischemic attacktribasic sodium phosphatechlorpheniramine maleatearchibald percival wavellelectromechanical devicesir richard francis burtonkazakhstani monetary unitthryothorus ludovicianus
...View all with 23 letters...
Words (7)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyelectroencephalographiesmicroelectrophoreticallydichlorodifluoromethanesschizosaccharomycetaceaePhrases (197)
pelham grenville wodehouseargyroxiphium sandwicensedivision heterokontophytaprivately held corporationtrip the light fantastic toeprimary sex characteristicbattle of the little bighornbattle of the spanish armadabrassica oleracea acephalaadolf otto reinhold windaus
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyantiestablishmentarianismPhrases (129)
igor fyodorovich stravinskysymphoricarpos orbiculatuscruel and unusual punishmentdistinguished service medaltherapeutic rehabilitationboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionproprietorship certificatepolystichum acrostichoides
...View all with 25 letters...
Phrases (108)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidx-linked dominant inheritancesir sarvepalli radhakrishnanright atrioventricular valvealternanthera philoxeroidescorrectional rehabilitation
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (78)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkinelectromechanical transduceraugustus welby northmore pugindirector-stockholder relationfreedom from search and seizurejerusalem artichoke sunfloweradrenocorticotrophic hormonethyrotropin-releasing hormone
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (73)
aleksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngergallinula chloropus cachinnansfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskydistinguishing characteristicthird council of constantinoplejohan julius christian sibelius
...View all with 28 letters...
Phrases (44)
aleksandr nikolayevich scriabinchemical decomposition reactionfriedrich wilhelm august froebeldisorganized type schizophreniadmitri dmitrievich shostakovichcapital of the dominican republicsouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitferdinand joseph la menthe morton
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (34)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovaalexander isayevich solzhenitsynbachelor of arts in library sciencedouble standard of sexual behaviorjacques anatole francois thibaultethylenediaminetetraacetic acidrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorov
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (31)
united states public health servicebureau of intelligence and researchmarie louise elisabeth vigee-lebrunsir john frederick william herschelfrances elizabeth caroline willardchickasaw national recreation areaanicius manlius severinus boethiusprimary subtractive color for lightoscar fingal o'flahertie wills wildefrancoise-athenais de rochechouart
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (19)
nikolai andreyevich rimski-korsakovafrican american vernacular englishhierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociation
...View all with 32 letters...
Phrases (20)
characteristic root of a square matrixbreach of trust with fraudulent intentbureau of alcohol tobacco and firearmsorganization of the oppressed on earthelizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometer
...View all with 33 letters...
Phrases (17)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzhermann ludwig ferdinand von helmholtzdryopithecus rudapithecus hungaricusfederal home loan mortgage corporation
...View all with 34 letters...
Phrases (12)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadeimmaculate conception of the virgin maryhereditary motor and sensory neuropathychristopher william bradshaw isherwoodfederal democratic republic of ethiopiatransurethral resection of the prostatesubacute sclerosing leukoencephalitis
...View all with 35 letters...
Phrases (11)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weber
...View all with 36 letters...
Phrases (10)
sisters of the order of saint basil the greatfirst epistle of paul the apostle to timothytheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordersecretary of housing and urban developmentdepartment of health education and welfarekarl friedrich hieronymus von munchhausencongregation of the sisters of saint hedwigsupreme headquarters allied powers europe