Words Containing: H,A,I,L,Y
(In Any Order)
There are 2,136 words,
1,978 phrases and
0 abbr's with
H,A,I,L,Y in.
Best Scoring Words With: H,A,I,L,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| hazily | 6 | 21 | adverb, adjectiveadv, adj | |||||
adverb • through a haze • in an indistinct way | ||||||||
| happily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in a joyous manner • in an unexpectedly lucky way | ||||||||
| shakily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in an insecurely shaky manner • in a manner characterized by trembling or shaking | ||||||||
| hammily | 7 | 17 | ||||||
Valid word for Scrabble US
| ||||||||
| heavily | 7 | 16 | adverbadv | |||||
adverb • to a considerable degree • in a heavy-footed manner • with great force • in a manner designed for heavy duty • slowly as if burdened by much weight • in a labored manner • indulging excessively | ||||||||
| charily | 7 | 15 | adverbadv | |||||
adverb • with great caution; warily | ||||||||
| clayish | 7 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| lehayim | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| apishly | 7 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
hailyWords (52)
physicalalmightydaylightmythicalladyshipladyfishchivalryheartilyhimalayalavishlyphysaliaachinglyshabbilyhilaritygarishlyrakishlyhayfieldflashilychattilyholidayshyalinespatchilyhyaloidsaguishlyoafishlyshaggilyearthilychancilyhydrillahymenialwrathilyhyaliteslechayimlehayimshaploidy
...View all with 8 letters...
Phrases (5)
hail maryally withwill hayshill mynacity hallWords (126)
hairstylehimalayaslabyrinthhydraulicdaylightsunhappilyplaythingchlamydiaethicallyhimalayanoligarchychantillyhealthilychrysalislymphatichaltinglywealthilypsychicaldashinglyinhumanlyhaughtilyslavishlylethalitychrysalidmawkishlyfaddishlyknavishlythyroidalnaughtilyraffishlyholidayerhypnoidalhelicallythroatilyvampishly
...View all with 9 letters...
Phrases (7)
hair stylewhile awayelihu yaleholy grailbill haleywill h. hayschina clayWords (184)
physicallyhystericalfaithfullyhydraulicschemicallystealthilyplaywrightscathinglycharminglyheroicallyhabituallyfreakishlystraightlyethnicallysmashinglyhauntinglylaughinglyrhythmicalcharitablyhypoplasiamysophiliainhumanelyepiphysealepiphysialcrashinglyhaemolysishaemolytichesitantlyanaglyphicholidayersgothicallypolyphagiaethylatingprankishlycheapishly
...View all with 10 letters...
Phrases (18)
chalcid flyspanish flyhanging flyray of lightbasil thymehemp familychalcis flyrush familychild's playdaisy wheel
...View all with 10 letters...
Words (204)
technicallyhospitalitycalligraphyfashionablychronicallyhairstylistsphericallyphysicalitypsychicallyrhinoplastyhilariouslypsychedeliageophysicalgraphicallyhypokalemiabiophysicalhypokalemichypoplasticmethylaminelithographyharrowinglyravishinglyfilmographysqueamishlyhomicidallyanaphylaxischaoticallynonphysicalprophylaxishyperplasiaunthinkablyunhealthilyunethicallyamphibologyhypophysial
...View all with 11 letters...
Phrases (37)
high qualitybilly grahamalkyl halidelamp chimneyholding yardsylvia plathship's galleyhigh holidaypearl hominyochna family
...View all with 11 letters...
Words (292)
hypocriticalhypotheticalhistoricallymetaphysicalmythologicalhystericallyhorizontallytechnicalitypatheticallyanaphylacticrhythmicallymechanicallyperipherallytriumphantlyemphaticallyphilanthropyharmoniouslymethodicallyprophylacticpsychosocialhermeticallytheatricallybibliographyenchantinglyhyperkalemiabehaviorallythematicallyphoneticallyexhaustivelyhorrificallydishonorablyhygienicallyhypoglycemiahypnoticallyathletically
...View all with 12 letters...
Phrases (56)
shaking palsyathletic typephantasy lifepolicy changemarilyn hornephysical bodylibyan dirhamal ladhiqiyahwild hyacinthtimothy leary
...View all with 12 letters...
Words (279)
psychologicaltheoreticallyhomosexualityphysiologicalastonishinglyaestheticallyhypoglycaemichallucinatoryhydraulicallytheatricalityhypercalcemiahumiliatinglystaphylococcisyntheticallytypographicalacetylcholinetheologicallysyphilizationunimpeachablylymphoblasticrhapsodicallyendolymphaticnightmarishlypolychromaticcatharticallyhydrocephalicpropheticallyadmonishinglyauthenticallyunfashionablyhypercriticalastrophysicalthreateninglydishonourablyinexhaustibly
...View all with 13 letters...
Phrases (65)
el iskandriyahheavy particleedmund hillarymusical rhythmrichard leakeymyles standishfamily historyphysical goodsvachel lindsaygraphic symbol
...View all with 13 letters...
Words (303)
hypotheticallypsychoanalysismetaphoricallymathematicallygeographicallyalphabeticallypathologicallyhyperventilatepsychoanalyticmetaphysicallytelepathicallyscholasticallyinheritabilityorthopedicallyarchetypicallyunthinkabilitybiographicallytelephonicallyanesthesiologynymphomaniacalunhesitatinglyethnologicallypraiseworthilyhyperbolicallybrachycephaliclyophilizationempatheticallystretchabilitymonolithicallylightheartedlyaminophyllineshypermasculinehypoallergenicmachineabilitymethylxanthine
...View all with 14 letters...
Phrases (96)
busman's holidaytypha latifoliachinese parsleyoriental cherryfamily bothidaephylum annelidaartillery shellbahasa malaysiaphylum poriferafly in the face of
...View all with 14 letters...
Words (262)
psychologicallytechnologicallyanaesthesiologyphysiologicallyphilosophicallyheterosexualitychronologicallyparentheticallytherapeuticallymethylphenidatelogarithmicallyauthoritativelyhypochondriacalsympatheticallyarchitecturallydemographicallyheartbreakinglyeuphemisticallypsychiatricallyimperishabilitykinestheticallythyrocalcitoninapproachabilityunchangeabilitypsychedelicallyalgorithmicallyhydromechanicalmerchantabilityphysiographicalmethylxanthinespsychoanalyzingpolysaccharidesdisenchantinglysycophanticallydishearteningly
...View all with 15 letters...
Phrases (153)
dialysis machinefamily lophiidaenational holidayjemaah islamiyahmythical monsterlymphatic vesselchicory escarolebuckthorn familybathyal districtautophytic plant
...View all with 15 letters...
Words (126)
enthusiasticallycatastrophicallytriphenylmethanehyperventilationpsychoanalyticalphylogeneticallypharmaceuticallyerythroblastosisthermostaticallypsychobiologicalphotographicallyparapsychologisthypersalivationsinextinguishablypornographicallythermometricallyantistrophicallyspondylarthritisradiographicallyhypersexualitiespolyphyleticallyinexhaustibilitypolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparapsychologieshyperventilatinghypocoristicallyphotolithographynonpsychologicalthyrocalcitoninsarchaeologicallypathophysiologic
...View all with 16 letters...
Phrases (178)
italian greyhoundcapital of hungarywilliam wycherleychemical analysisalan lloyd hodgkindwight lyman moodynevil shute norwaymechanical systemschool dictionarymythical creature
...View all with 16 letters...
Words (90)
straightforwardlyanthropologicallythermodynamicallyphilanthropicallycercidiphyllaceaeunexchangeabilityhyperstimulationsparapsychologistshyperventilationsmonochromaticallyhypnotizabilitieshypochondriacallychlortetracyclinepathophysiologiesarchitectonicallymorphogeneticallylexicographicallyencephalomyelitiscrystallographieslymphadenopathieshyperalimentationlymphangiographiccyclophosphamidespharmacologicallyoceanographicallythiodiphenylaminephenylethylaminesbibliographicallytransthoracicallynephelometricallyelectrochemicallydehydrochlorinasezoogeographicallydehydrochlorinateptilonorhynchidae
...View all with 17 letters...
Phrases (193)
salvia leucophyllahypoglycemic agentsubphylum craniatatheological systemfamily trochilidaefamily didelphidaecalycanthus familyrepublic of hungarytypha angustifoliapython reticulatus
...View all with 17 letters...
Words (60)
characteristicallyhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilitysociopsychologicalneuropsychologicalspectroheliographypathophysiologicallaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographieshyperbilirubinemiaimmunocytochemicalstoichiometricallyautobiographicallydiethylmalonylureadistinguishabilitymucopolysaccharidehypercholesteremiaphenomenologicallyhydroflumethiazideophthalmologicallygeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesoscillographicallyspectrographicallyelectromyographiesmetallographicallydemythologizationshistocompatibilitydephosphorylations
...View all with 18 letters...
Phrases (193)
family physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyclass schizomycetesread-only memory chipfamily trichechidaeshort-term liabilityfamily loranthaceaearchitectural style
...View all with 18 letters...
Words (49)
hydrochlorothiazidepsychophysiologicalcinematographicallyotorhinolaryngologyhypolipoproteinemiaparthenogeneticallymucopolysaccharideslipopolysaccharidesbacteriochlorophyllpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallyanthropocentricallyanthropomorphicallyelectroretinographycharacterologicallycortico-hypothalamicencephalomyelitideshistopathologicallyphenylpropanolaminehistoriographicallyhydroxytetracyclinehydrometeorologicalpsychopharmacologicdiethylcarbamazines
...View all with 19 letters...
Phrases (192)
giles lytton stracheyphytolacca americanacalycanthus floridusathyrium filix-feminahydrobates pelagicussymphytum officinalesubfamily mephitinaeprobability theoristsolidarity surchargefamily euphorbiaceae
...View all with 19 letters...
Words (33)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolcrystallographicallyindistinguishabilityimmunocytochemicallylymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallyhistoincompatibilityelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationhydrochlorothiazidespsychopathologicallypsychopharmacologiesmicrophotometricallypsychopharmacologisthypercoagulabilitiesdimethylnitrosaminesplethysmographicallyPhrases (183)
yellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaemarchantia polymorphabalance sheet analysisclyde william tombaughfamily dermochelyidaedianthus caryophyllusbenjamin henry latrobe
...View all with 20 letters...
Words (17)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologistmucopolysaccharidosisacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (136)
aleksandr solzhenitsynhelichrysum bracteatumfamily rhinotermitidaearctostaphylos uva-ursiptolemy ii philadelphusprocaine hydrochlorideagricultural chemistryfamily myrmecophagidaehans holbein the youngersyngnathus hildebrandi
...View all with 21 letters...
Words (7)
spectrophotometricallyotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (112)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynmultiple mononeuropathysodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesbrachycome iberidifolia
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (78)
family threskiornithidaecalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkerrichard brinsley sheridanhydrophyllum virginianumsir anthony philip hopkinscamptosorus rhizophyllussir harry maclennan lauder
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (55)
privately held corporationexistentialist philosophytechnology administrationsir charles leonard woolleychrysosplenium americanumhaematoxylum campechianumoxidative phosphorylationelectroconvulsive therapypaul johann ludwig von heyseantiphospholipid antibody
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (48)
symphoricarpos orbiculatuspolystichum acrostichoidescaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddingtonanthony charles lynton blairtympanuchus pallidicinctusembryonic stem-cell researchreticuloendothelial systemaleksey maksimovich peshkov
...View all with 25 letters...
Phrases (34)
employee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authorityair force research laboratorycircumflex artery of the thighsystemic lupus erythematosus
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (29)
holy roman emperor frederick iialeksandr sergeyevich pushkinaugustus welby northmore puginthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteinhyacinthus orientalis albulusnikolai ivanovich lobachevskyatrioventricular nodal rhythmhydraulic transmission system
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (25)
aleksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl cellulose
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (12)
aleksandr nikolayevich scriabinhydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevskycontinuity irish republican army
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidhyperbilirubinemia of the newbornhenri rene albert guy de maupassanttechnical analysis of stock trendsfamily schizosaccharomycetaceaeprovisional irish republican army
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (8)
digital communications technologyprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontovulation method of family planningvladimir vladimirovich mayakovskinorth atlantic treaty organizationmary godwin wollstonecraft shelleyPhrases (10)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkoattorney general of the united statesjohn f. kennedy international airport
