Words Containing: G,R,Y,K,E
(In Any Order)
There are 71 words,
163 phrases and
0 abbr's with
G,R,Y,K,E in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
kerygma | 7 | 17 | nounn | |||||
noun • preaching the gospel of Christ in the manner of the early church | ||||||||
yerking | 7 | 15 | verbv | |||||
verb • To stab. • To throw or thrust with a sudden, smart movement; to kick or strike suddenly; to jerk. • To strike or lash with a whip or stick. • To rouse or excite. • To bind or tie with a jerk. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
grykeWords (1)
grykesWords (12)
skullduggeryhyperlinkingflickeringlymerrymakingskymographieskremlinologyskyrocketingkeyboardingspony-trekkingkeystrokingsblackish-greygreyish-blackPhrases (12)
grey kingbirdgeorgy zhukovkey signaturemercy killingyorkshire fogwayne gretzkyrayleigh diskgrease monkeyrusty gracklemonkey bridge
...View all with 12 letters...
Words (7)
breathtakinglyearthshakinglymegakaryocyticmegakaryocytesblackberryingshuckleberryingkinematographyPhrases (17)
veliky novgorodemergency braketurkey stuffingkyrgyz republichenry kissingerbrooklyn bridgegreater new yorkbyzantine greekdrive-by killinggreek mythology
...View all with 14 letters...
Phrases (1)
microsoft disk operating systemPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
enzyme-linked-immunosorbent serologic assay