Words Containing: G,N,Y,A
(In Any Order)
There are 2,814 words,
2,437 phrases and
0 abbr's with
G,N,Y,A in.
Best Scoring Words With: G,N,Y,A
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
lazying | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
yakking | 7 | 19 | verb, adverbv, adv | |||||
noun • noisy talk • large long-haired wild ox of Tibet often domesticated verb • talk profusely | ||||||||
taxying | 7 | 18 | verbv | |||||
Valid word for Scrabble US
| ||||||||
jargony | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
jangly | 6 | 17 | adjectiveadj | |||||
adjective satellite • like the discordant ringing of nonmusical metallic objects striking together | ||||||||
yacking | 7 | 17 | verb, nounv, n | |||||
noun • noisy talk verb • talk incessantly and tiresomely | ||||||||
yaffing | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
magnify | 7 | 16 | verbv | |||||
verb • increase in size, volume or significance • to enlarge beyond bounds or the truth • make large | ||||||||
syngamy | 7 | 16 | nounn | |||||
noun • The fusion of two gametes to form a zygote. | ||||||||
yawping | 7 | 16 | verb, nounv, n | |||||
verb • make a raucous noise • complain whiningly | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
yangWords (125)
playingstayinggermanynaughtyhungaryyappinglangleyyawninganalogygymnastyangtzeslayingangrilymagnifyvaryinggangwayyakkinggrandlygranarygunplayorgandygaynessstygianorangeygainsayspayingbabyingyeggmandaylongluoyangspanglynosegaygasconygauntrysyntagm
...View all with 7 letters...
Phrases (1)
gray henWords (237)
anythingcarryingmarryingannoyingegyptianpartyingapplyingyearningsprayingstingraymahoganymonogamybogeymanrallyingstrayingvagrancygreenwayguarantydallyingshenyangrelayingfancyingtarryinghogmanaybelayinglongwaysallayingganymedereadyingnegatoryyachtinggraylingtallyinglayeringungainly
...View all with 8 letters...
Phrases (15)
zane greysign awaybandy legun agencyyoung mangenus myalaying onlang synegreen baycandy egg
...View all with 8 letters...
Words (385)
generallypregnancylegendaryimaginarystrangelyamazinglysynagogueanalyzingdragonflypyongyanghemingwaygymnasiummoneybagsclergymanboogeymanplaythinganalysinguruguayanelegantlygallantryeasygoinganthologygenealogydignitaryvaryinglyglaringlypygmalionpageantrygymnasticbypassingsparinglyhydrangeagallantlypacifyingquarrying
...View all with 9 letters...
Phrases (29)
bon voyagecary grantegg layinggunny sackgenus nypaagony auntany longeryoung ladyyouth gangeasy going
...View all with 9 letters...
Words (411)
originallyplaygroundsatisfyinggymnasticsgranddaddymagnifyingqualifyingnegativitygratifyingnegativelyscathinglyportrayingcharminglyarrogantlyclarifyingdiagonallysingularlyfalsifyingannoyinglyoverpayingdynamitingflagrantlygastronomylaryngitisalarminglyparalysingmenacinglyoxygenatedhighwaymanamplifyingparaguayanmarginallymalignancyremarryingpharyngeal
...View all with 10 letters...
Phrases (74)
yves tanguygenus khayagenus cycassugar candydry wallingwedding dayhanging flygenus physapaying backfading away
...View all with 10 letters...
Words (403)
geneticallyaccordinglybabysittingdaydreamingdangerouslyoriginalitysingularitygentlemanlyiconographyorganicallyinteragencyyugoslavianappallinglyplaywritingangelicallypythagoreandehydratingantigravityandrogynousquantifyingmalignantlycopycattingindignantlymagnanimityunceasinglyangioplastyfragmentaryclassifyingunfailinglygrandiositygynaecologyoxygenationbricklayingmoneymakingmerrymaking
...View all with 11 letters...
Phrases (126)
genus lycosalaying claimlaying wastegenus styraxroentgen rayhoney badgerplaying areaglossy snakedry cleaningrunning play
...View all with 11 letters...
Words (338)
increasinglyaccompanyinganthropologyunsatisfyingunimaginablycongenialitypaleontologyoceanographyungraciouslystaggeringlyenchantinglymagneticallyhydrogenateddespairinglyhygienicallyhypogonadismlaryngoscopelollygaggingunwaveringlygratifyinglybullyragginglallygagginghydroplaningcontagiouslylaryngoscopyaboriginallyunforgivablyreassuringlyconveyancingmeaningfullymulligatawnyasphyxiatingastoundinglynauseatinglycongenitally
...View all with 12 letters...
Phrases (158)
mary magdalenstaying powershaking palsygenus syringainquiry agentgenus cydoniapolicy changegenus apteryxgenus tayassubenny goodman
...View all with 12 letters...
Words (304)
significantlygynaecologistmagnificentlyastonishinglyeverlastinglypainstakinglyoveranalyzingdehydrogenaseinfuriatinglyenergeticallyextravagantlyungentlemanlygynecologicaldisparaginglydeoxygenationpalaeontologyhumiliatinglymeaninglesslyanthropophagycrystallizingfascinatinglyunoriginalityhydrogenationunforgettablyoverbearinglynostalgicallydillydallyingmyoglobinuriapalynologicalnightmarishlyoutstandinglymagnanimouslytantalizinglygeostationaryintangibility
...View all with 13 letters...
Phrases (193)
harvey cushingvaginal arteryyakut languagecygnus atratushigh-and-mightywaste of energygenus bradypusdwindling awaygenus cyclamencedar mahogany
...View all with 13 letters...
Words (215)
cinematographynanotechnologycongratulatoryexcruciatinglygynaecologicalembarrassinglylinguisticallygovernmentallyentertaininglydiagnosticallyneuropathologyanesthesiologydisapprovinglyunhesitatinglyethnologicallymagniloquentlyimpregnabilityadvantageouslygenerationallyinsignificancyinfrangibilitydiscouraginglydehydrogenasesdisquantityinghypoallergenicinvigoratinglygenealogicallyegocentricallyintimidatinglyacceleratinglyunappetizinglymisclassifyingantiregulatoryexasperatinglyilluminatingly
...View all with 14 letters...
Phrases (212)
anthony burgesslachrymal glandtubal pregnancypituitary glandigor stravinskyemergency brakedrainage systemmargin of safetygenus chrysaorarudyard kipling
...View all with 14 letters...
Words (167)
technologicallyanaesthesiologychronologicallysynergisticallydisappointinglyrecrystallizingencephalographytransmogrifyinggastronomicallygynandromorphicheartbreakinglyinterrogativelyultrasonographyaccommodatinglyagranulocytosisunchangeabilitycommiseratinglypsychoanalyzingdisenchantinglydishearteninglynonbiologicallyphytopathogenicdistinguishablyuncopyrightableoverclassifyinghypervigilancesresystematizinguncomplaininglyphosphorylatingentomologicallyroentgenographyagranulocytosesgnotobioticallyunderstandinglyontogenetically
...View all with 15 letters...
Phrases (234)
syringa vulgarisasamiya languagemount nyiragongomail-order buyingwystan hugh audengenus sylvilagusgenus bombycillahyoscyamus nigergenus cyanocittacantering rhythm
...View all with 15 letters...
Words (66)
phylogeneticallysphygmomanometerunapologeticallyinextinguishablypornographicallyparamagneticallyotolaryngologisthyperstimulatinghyperventilatingsphygmomanometryglossopharyngealnonpsychologicalhemoglobinopathycriminologicallycrossopterygiansorganizationallyiconographicallylyginopteridalesstenographicallyhypopigmentationflabbergastinglynonsignificantlygastroenterologylymphogranulomasindefatigabilitystrongyloidiasesstrongyloidiasislymphangiectasialymphangiectasislymphangiographyconsanguineouslyimmunohematologygeneralizabilityimmunoregulatoryorganoleptically
...View all with 16 letters...
Phrases (219)
italian greyhoundstrictly speakingchristian huygenscapital of hungarycygnus buccinatorgenus crotaphytusbluegrass countrycommercial agencyalan lloyd hodgkindwight lyman moody
...View all with 16 letters...
Words (37)
anthropologicallyunexchangeabilitysphygmomanometersferrimagneticallymorphogeneticallylaryngopharyngealmicropaleontologylymphangiographicgastroenterostomylymphogranulomatacytopathogenicityprotoanthropologyconfigurationallyimmunogeneticallyelectronegativityoceanographicallysamoyedic-speakingglossopharyngealsphonocardiographyglycosaminoglycantrigonometricallyneuropharmacologyotolaryngologicalotolaryngologistsdisadvantageouslygynandromorphismsangiocardiographyhyperpigmentationdephosphorylatingpalaeoethnographydemythologisationdemythologizationdihydroergotaminehaemoglobinopathyindistinguishably
...View all with 17 letters...
Phrases (209)
dame margot fonteynhypoglycemic agentinterstate highwaypearly everlastinggenus symphalangusmalaysian languageantipsychotic drugcylindrical liningrepublic of hungarytypha angustifolia
...View all with 17 letters...
Words (24)
interchangeabilityneuropsychologicalsphygmomanometrieslaryngopharyngitislymphangiographiesdistinguishabilitymagnetostrictivelyphenomenologicallygeochronologicallyglycosaminoglycansgranulocytopoiesesgranulocytopoiesisultracentrifugallydemythologizationspropagandisticallyrhinolaryngologistpalaeoanthropologyroentgenologicallysedimentologicallyindiscriminatinglyphytohemagglutinindihydroergotaminesneurophysiologicalhyperpigmentationsPhrases (214)
revolutionary groupfreudian psychologygenus styracosaurusafghan monetary unitnavigational systemantipsychotic agentmegacycle per secondgenus chamaecytisusfulminating mercuryfamily magnoliaceae
...View all with 18 letters...
Words (15)
cinematographicallyextralinguisticallyotorhinolaryngologyparthenogeneticallycrosslinguisticallycytopathogenicitiesmagnetohydrodynamicechoencephalographydehydrochlorinatingelectromagneticallyhysterosalpingogramcross-linguisticallyelectroretinographyphytohemagglutininssociolinguisticallyPhrases (145)
family cynoglossidaealpine type of glaciergiles lytton stracheygenus cryptobranchusgenus symphoricarposbond-trading activitycapital of kyrgyzstansalicylate poisoninguniversity of chicagocrataegus oxyacantha
...View all with 19 letters...
Words (10)
indistinguishabilitylymphogranulomatoseslymphogranulomatosismagnetofluiddynamicsoophorosalpingectomyneurophysiologicallymagnetohydrodynamicsroentgenographicallysyncategorematicallypalatopharyngoplastyPhrases (127)
oryctolagus cuniculusbyelorussian languagemagnetic bubble memoryclassifying adjectiveluscinia megarhynchosa-scan ultrasonographyunabridged dictionarymilitary intelligencelaw enforcement agencyegyptian monetary unit
...View all with 20 letters...
Words (6)
hypogammaglobulinemiaotorhinolaryngologistotorhinolaryngologiesdendrochronologicallyantiferromagneticallyclinicopathologicallyPhrases (92)
igor ivanovich sikorskybulgarian monetary unithungarian monetary unitextrauterine pregnancycynoglossum officinaleginglymostoma cirratumnorwegian monetary unitstrawberry haemangiomasoren aabye kierkegaardhans holbein the younger
...View all with 21 letters...
Words (3)
electroencephalographyotorhinolaryngologicalotorhinolaryngologistsPhrases (85)
guatemalan monetary unitnicaraguan monetary unitparaguayan monetary unitamygdalus communis amarahenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucasedward kennedy ellingtonbahasa malaysia language
...View all with 22 letters...
Words (1)
laryngotracheobronchitisPhrases (52)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinsir terence mervyn rattigantechnology administrationfederal republic of germanyhenry wadsworth longfellowandrei andreyevich gromykopaul johann ludwig von heyseposterior meningeal artery
...View all with 24 letters...
Words (1)
uvulopalatopharyngoplastyPhrases (28)
igor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencybeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigadespodkamennaya tunguska rivercygnus columbianus bewickii
...View all with 25 letters...
Phrases (27)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinsubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsubdivision mastigomycotinasystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (22)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Phrases (17)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguecygnus columbianus columbianusimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonecentral intelligence machinery
...View all with 28 letters...
Phrases (10)
disorganized type schizophreniaautomatic data processing systemscrutin uninominal voting systemedward george earle bulwer-lyttonhydrangea macrophylla hortensisnational intelligence communityfrancisco jose de goya y lucientespressure-feed lubricating systemenvironmental protection agencyimaginary part of a complex numberPhrases (11)
great smoky mountains national parkdigital communications technologyport-access coronary bypass surgeryrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planningnorth atlantic treaty organizationdefense information systems agency
...View all with 31 letters...
Phrases (11)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory drugoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisfederal emergency management agencyattorney general of the united statesbosnian-herzegovinian monetary unit
...View all with 32 letters...
Phrases (10)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay