Words Containing: G,G,H,I,I,N
(In Any Order)
There are 369 words,
354 phrases and
0 abbr's with
G,G,H,I,I,N in.
Best Scoring Words With: G,G,H,I,I,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| hinging | 7 | 12 | verbv | |||||
verb • To attach by, or equip with a hinge. • (with on or upon) To depend on something. • The breaking off of the distal end of a knapped stone flake whose presumed course across the face of the stone core was truncated prematurely, leaving not a feathered distal end but instead the scar of a nearly perpendicular break. • To bend. | ||||||||
| sighing | 7 | 12 | verbv | |||||
noun • an utterance made by exhaling audibly • a sound like a person sighing verb • heave or utter a sigh; breathe deeply and heavily • utter with a sigh | ||||||||
| nighing | 7 | 12 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (39)
lightningalightingweightingunhinginghigginsonshinglingplightingsightingswhingeingblightingslightingfightingshagridinglightingsrehingingflightinghogtieingwhingdingfrightingsleighingknightingunsighingsight-singquightinggraithingsightsingweighingsbesighingthiggingsright-wingrightingssmightingsighinglyghillyingtwighting
...View all with 9 letters...
Words (47)
lighteningtighteninginfightinganguishinggarnishingchagriningdelightingbedightingrelightinginveighingskreighinguprightingfreightingunsightinglighteringenglishinglightningsscraighingresightingreweighingrefightingwhingdingsuplightingundightingscreighingthingmajigungirthinglightlyingshoogieingweightingssprightingrighteninghighflyingbenightingwhingeings
...View all with 10 letters...
Phrases (1)
fishing rigWords (61)
frighteningnightingalesightseeingneighboringgunfightinglanguishingthingamajigthingumajigheighteningslightinglyshanghaiingpiggishnesshighjackingdischargingchinwaggingoutweighingdaylightinginfightingsrightsizingghettoizingmislightinghighballingbrighteningoutfightinghightailingingatheringgothicizingchagrinningreshinglingbeknightinglightningedgunsmithingpreweighinghiccoughingmischarging
...View all with 11 letters...
Phrases (9)
hang glidingvoting rightgiving birthriding lighthinging postfishing gearsignal lightking whitingliving thingWords (65)
thanksgivingenlighteningneighbouringmoonlightingbullfightinghighlightingcockfightinghomogenizingbacklightingpriggishnesspigeonholingovernightingharbingeringhomogenisingingatheringsretighteningthingamajigshomologizingpreflightingthingumajigsangiographiclimelightingoverlightinggarnisheeinggunsmithingsgraphitizingoverweighingdaylightingsdiaphragmingcopyrightingjacklightingspotlightingghostwritingnightingalesdiphthonging
...View all with 12 letters...
Phrases (24)
genus blighiafishing eagleleading lightguiding lightfighting cockwarning lightlightning buglightning rodsight settingrunning light
...View all with 12 letters...
Words (56)
frighteninglyextinguishingprizefightingweightliftingnightclubbinginterchangingphagocytizinganthologizingplaywrightingairfreightingfloodlightingheliographingpiggishnessesherringboningmimeographingangiographiesthanksgivingscockfightingslithographingoverweightingstraighteninggreenlightingradiographingmythologizinglanguishinglymicrographinghemagglutininbullfightingsanthologisinghigh-ceilingedgigantomachiadisgarnishinggalravitchingginkgophytinacliffhangings
...View all with 13 letters...
Phrases (20)
high-and-mightyirish languagehindi languageshipping agentsheet lightinghigh-angle firegenus knightiateng hsiao-pingteng hsiaopingstrip lighting
...View all with 13 letters...
Words (32)
distinguishingunenlighteningpsychologizingovertighteningplaywrightingsthimbleriggingtechnologizingpsychologisingpriggishnessestrothplightingprizefightingsdiphthongizinghemagglutininsgigantomachiasgigantomachiesfloodlightingsgenethlialogicweightliftingsmachinegunningpredischargingfashionmonginghaemagglutinintechnologisingoverfreightinggillravitchingchronologisingchronologizingphrenologisingphrenologizingnightclubbingsdiphthongisingmicrolightingsPhrases (21)
anhinga anhingatightly fittingbargaining chipvirgo the virginbihari languagepitching changedaylight savingwalpurgis nightswaging machinesir john gielgud
...View all with 14 letters...
Words (19)
orthogonalizingdemythologizingremythologizingcounterweighingdemythologisinggenethlialogiesdehydrogenisingdehydrogenizingcineangiographyhaemagglutininsthimbleriggingsorthogonalisingenglish-speakingmarconigraphingremythologisingstraight-grainedapothegmatisingapothegmatizingphlogisticatingPhrases (37)
swahili languagegeographic pointsocial gatheringugandan shillingchange integritylogical thinkinglightning hurlerdaylight savingsgenus gleichenianavigation light
...View all with 15 letters...
Words (5)
counterweightinghemagglutinatinghemagglutinationoverhomogenizingcholangiographicPhrases (31)
exercising weightgeographic regionkhirghiz languagekashmiri languagegreenwich villagewashington irvingold irish languagevaginal dischargeindirect lightingtahitian language
...View all with 16 letters...
Words (6)
lymphangiographicstraightjacketinghemagglutinationsangiocardiographyhaemagglutinationcholangiographiesPhrases (25)
kiswahili languageengineering schoolclimbing hydrangeageological horizondivergent thinkingethiopian languagetsimshian languagetelegraphic signalthrush nightingalejunior lightweight
...View all with 17 letters...
Words (7)
laryngopharyngitislymphangiographiesangiocardiographicphotolithographingrhinolaryngologistgood-neighborlinessphytohemagglutininPhrases (32)
hindustani languagehallucinogenic drugstinking nightshadeextreme right-wingerthanksgiving cactusgeographical regionswedish nightingalelight-emitting diodegraphical recordingwhispering campaign
...View all with 18 letters...
Words (5)
photodisintegratingangiocardiographiesgood-neighbourlinesschromolithographingphytohemagglutininsPhrases (25)
john millington syngeirish gaelic languageagrippina the youngerflorence nightingalehindoostani languagegeorge hubert wilkinsthrough bill of ladingdaylight-savings timegenus ischigualastialightweight concrete
...View all with 19 letters...
Words (3)
hypogammaglobulinemiaotorhinolaryngologistotorhinolaryngologiesPhrases (15)
anigozanthus manglesiihaitian creole languagephysostegia virginianamechanical engineeringmargaret higgins sangermagnetic field strengthgiovanni angelo braschiangiogenesis inhibitornothofagus cuninghamiicharles edward ringling
...View all with 21 letters...
Words (2)
otorhinolaryngologicalotorhinolaryngologistsPhrases (19)
ivan sergeevich turgenevgotthold ephraim lessingsouth dravidian languagescottish gaelic languagesubdivision ginkgophytaposthypnotic suggestiongeorge washington bridgevariegated scouring rushechidnophaga gallinaceahigher cognitive process
...View all with 22 letters...
Phrases (11)
distinguished flying crosshunting and gathering tribeultra-lightweight concretesubdivision ginkgophytinaarchitectural engineeringchiricahua apache languagegrigori efimovich rasputinmiddle high german languagehilaire germain edgar degasoesophagogastric junction
...View all with 24 letters...
Phrases (1)
angiotensin-converting enzyme inhibitorPhrases (1)
congregation of the sisters of saint hedwig
