Words Containing: FIE
(In Exact Order)
There are 1,031 words,
214 phrases and
0 abbr's with
FIE in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jiffies | 7 | 20 | nounn | |||||
noun • a very short time (as the time it takes the eye to blink or the heart to beat) | ||||||||
| fiefdom | 7 | 16 | nounn | |||||
noun • the domain controlled by a feudal lord • an organization that is controlled by a dominant person or group | ||||||||
| huffier | 7 | 16 | adjectiveadj | |||||
adjective satellite • quick to take offense • roused to anger | ||||||||
| waffies | 7 | 16 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| puffier | 7 | 15 | adjectiveadj | |||||
adjective satellite • being puffed out; used of hair style or clothing • abnormally distended especially by fluids or gas • blowing in puffs or short intermittent blasts | ||||||||
| buffier | 7 | 15 | ||||||
Valid word for Scrabble US
| ||||||||
| miffier | 7 | 15 | ||||||
Valid word for Scrabble US
| ||||||||
| baffies | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| waffie | 6 | 15 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| biffies | 7 | 15 | nounn | |||||
noun • A toilet • An outhouse | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
fieWords (176)
garfieldmodifiednotifiedfieldingverifiedcanfieldfiercelyairfieldpurifiedmidfieldpacifierfiercestfiendishpurifierratifiedoldfieldoutfieldvilifiedpacifiedrarefiedcodifiedrarifiedcitifiedpuffiestvivifiednazifiedfluffiermodifiergoofiesttypifiedossifiedramifiedhayfieldratifiergasified
...View all with 8 letters...
Phrases (8)
field hutw. c. fieldsfield gunfield daybit fieldfield peahop fieldice fieldWords (292)
satisfiedterrifiedqualifiedjustifiedcertifiedcrucifiedtestifieddignifiedhorrifiedpetrifiedmortifiedfortifiedclarifiedglorifiedmummifiedminefieldcornfieldamplifiermansfieldspecifiedfalsifiedamplifiedsheffieldmagnifiedfieldworkliquefiedrectifiermystifiedprokofievgratifiedmagnifierdownfieldbackfieldsignifiedrectified
...View all with 9 letters...
Phrases (17)
field coilfield tripcorn fieldball fieldfield goalleft fieldfield lensfield linefield cornfield balm
...View all with 9 letters...
Words (197)
identifiedclassifiedsanctifiedfieldstonesimplifiedgreenfieldbloomfieldsolidifiedoutfielderbeautifiedidentifieremulsifiedunmodifiedquantifiedfiendishlygoldfieldshumidifierfiercenessrepurifiedsaponifiedrevivifiedstratifiedunverifiedhumidifieddetoxifiedwheatfieldfalsifiersresinifiedsolidifiesdetoxifiesquantifiesfortifiersammonifiedjustifiersbeautifies
...View all with 10 letters...
Phrases (17)
field sportforce fieldfield guidefield glassfield trialfield pansyfield judgeright fieldfield maplefield mouse
...View all with 10 letters...
Words (153)
battlefieldspringfieldbakersfieldelectrifiedintensifiedunsatisfiedpersonifiedunqualifiedundignifiedmontgolfierunjustifieddiversifiedunspecifiedrecertifiedexemplifiedindemnifiedcountrifiedbutterfielddecertifiedfrenchifiedcenterfieldintensifiercountryfieddecalcifiesprenotifiesuncalcifiedpersonifiesrefortifiesrespecifiedsemideifiedgreenfieldskitschifiedreliquefiesdeacidifiesdiversifier
...View all with 11 letters...
Phrases (15)
field of viewfield rationleft fieldercenter fieldfield lupineflying fieldvisual fieldfield garlicsoccer fieldfield hockey
...View all with 11 letters...
Words (68)
unidentifieddisqualifieddissatisfieddeclassifiedchesterfieldunclassifiedunsanctifiedreclassifiesintensifiersprequalifieddissatisfiessaccharifiedprequalifiesresolidifiedpresignifiesfiercenessesdeclassifiessaccharifiesfiendishnessprespecifiedreidentifieddisqualifiesreclassifiedpreamplifierdehumidifiesprespecifiesreidentifiesnoncertifiedcomplexifiedpresignifiedindemnifiersdiversifierscomplexifiesdehumidifierdehumidified
...View all with 12 letters...
Phrases (25)
classified adright fielderfield of forcefield glassessubject fieldfield soybeantake the fieldfield spanielfield generalfield winding
...View all with 12 letters...
Words (32)
overqualifiedunqualifiedlymisidentifiedpreamplifierschesterfieldssubclassifiedfieldstrippedmisclassifiessubclassifiespresanctifiedunelectrifiednonesterifiedoveramplifiedmisidentifiesnonclassifiedmisclassifiedultrararefieddehumidifierscenterfielderpresanctifiesself-satisfieddignifiednessunexemplifiedmultiramifiedforesignifiedwell-qualifiedbrickfieldersforesignifiesdisqualifiersdisyllabifiedundiversifieddisyllabifiesPhrases (30)
henry fieldingarthur fiedlerfield marigoldfield strengthjohn masefieldfield of visioncenter fielderbaseball fieldfortified winebosworth field
...View all with 13 letters...
Words (15)
oversimplifiedunderqualifiedtransmogrifiedoverclassifiesfieldstrippingfiendishnessesoveridentifiesoverclassifiedbourgeoisifiednondiversifiedbourgeoisifiestransmogrifiesoveridentifiedoversimplifiesdissatisfiedlyPhrases (16)
field artilleryfielder's choicefield intensityaudio amplifierradiation fieldfield pussytoesjames a. garfieldbarney oldfieldfield chamomileoperative field
...View all with 14 letters...
Phrases (1)
field-sequential color tv systemPhrases (1)
field-sequential color televisionPhrases (1)
field-sequential color television system
