Words Containing: EN
(In Exact Order)
There are 27,411 words,
11,836 phrases and
19 abbr's with
EN in.
Best Scoring Words With: EN
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jazzmen | 7 | 34 | nounn | |||||
noun • a musician who plays or composes jazz music | ||||||||
| chazzen | 7 | 30 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| wizzens | 7 | 28 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| wizzen | 6 | 27 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| mizzens | 7 | 27 | nounn | |||||
noun • third mast from the bow in a vessel having three or more masts; the after and shorter mast of a yawl, ketch, or dandy • fore-and-aft sail set on the mizzenmast | ||||||||
| mizzen | 6 | 26 | noun, adjectiven, adj | |||||
noun • third mast from the bow in a vessel having three or more masts; the after and shorter mast of a yawl, ketch, or dandy • fore-and-aft sail set on the mizzenmast | ||||||||
| zazens | 6 | 24 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| zazen | 5 | 23 | nounn | |||||
noun • A form of seated meditation in Zen Buddhism. | ||||||||
| enzymic | 7 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| khazens | 7 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
enWords (1228)
listenenoughfriendhappenmomententirebrokenfrenchheavenenergytwentycenterclientgottenopenedplentyenginegardenstolengeniustalentsuddenhiddenfallensilentdecentgoldenspokenscreenchosenagencyseniordefendmentalbeaten
...View all with 6 letters...
Phrases (27)
tag endcow penpen nibbent onbig bensend insend onhenry ifag endopen up
...View all with 6 letters...
Words (2037)
betweeneveningpresentgeneralenglishchickenwrittenkitchenpatientstudentmentionweekendsciencepretendsilenceancientopeningenglandcenturydefenserevengesendinglicensecentralpercentcurrentviolentengagedfifteenstephensenatorbenefitbeneathpreventpayment
...View all with 7 letters...
Phrases (62)
w. h. audenblend intail endrent outbig bendtense upend usersend outlens captent peg
...View all with 7 letters...
Words (2880)
childrenaccidentevidencesuddenlynonsenseinnocentstrengthwheneverrecentlyaudienceviolencemovementpresencesentenceincidentfriendlyspendingbasementidentityentrancepresentsentirelypatiencetalentedmistakengenerousenormousidentifyargumentengineerenteringjudgmentreverendenvelopethreaten
...View all with 8 letters...
Phrases (131)
genus bosloose endfall openopium dendent cornjenny asssentry gowen ch'anggenus zeakeep open
...View all with 8 letters...
Words (3493)
differenthappeningpresidentboyfriendattentionlisteningapartmentexcellentforgottenexpensiveemergencygentlemantreatmentchallengeagreementstatementsensitiveequipmentpotentialsurrenderexistenceinfluenceadventureforbiddenrepresentscientistconfidentrecommendintentiondefendantpermanentcurrentlyencountersuspendedhalloween
...View all with 9 letters...
Phrases (313)
genus glisbitter endgenus craxlake nyasagenus crexpast tensegenus sulasheet bendscreen offenter upon
...View all with 9 letters...
Words (3948)
girlfriendgovernmentdifferenceexperiencedepartmentlieutenantapparentlyeventuallyfriendshipconfidenceconferencepunishmentgenerationfrightenedexperimentthreatenedpretendingconsciencescientificmanagementengagementinvestmentcommitmentassignmentidentifiedtournamentexcitementtremendousconvenientinstrumentretirementconventioncomplimentstraightenphenomenon
...View all with 10 letters...
Phrases (619)
tea essencegenus inulagenus lyguswoody allenskagen oddelake nasserbrya ebenusgenus sardatv audienceair current
...View all with 10 letters...
Words (3678)
appointmentcoincidenceconcentrateenvironmentintelligentthreateningexperienceddevelopmentdifferentlyforgivenessindependentmagnificentdocumentaryarrangementmaintenancefrighteningengineeringsentimentalreplacementessentiallyfundamentalchallengingenforcementcomplimentsconvenienceachievementcompartmentrepresentedimprovementinvolvementconsequencepotentiallypermanentlyinfluentialencouraging
...View all with 11 letters...
Phrases (839)
genus lycosagenus myxinegenus crambe's gravenhageskagens oddespace needlechurch benchgenus bletiadengue fevergenus styrax
...View all with 11 letters...
Words (3031)
intelligenceconsequencesannouncementpresentationindependenceaccidentallyinstrumentalconfidentialkindergartenpresidentialentertainingcompensationexperiencingunemploymentinterferenceinterventionexperimentalconcentratedconventionalimprisonmentpennsylvaniaunidentifiedenthusiasticincidentallyinconvenientfrankensteinsufficientlypenitentiaryentrepreneurdisagreementincompetenceindifferenceencyclopediaconsistentlytremendously
...View all with 12 letters...
Phrases (1103)
graham greeneathene noctuagenus porzanasecond adventgenus anethumhelen traubelgenus sturnusmary magdalenjan tinbergenmrs. henry wood
...View all with 12 letters...
Words (2339)
entertainmentconcentrationestablishmentgrandchildrenenvironmentalembarrassmentinconvenienceenlightenmentunprecedentedintentionallyconcentratingencouragementadvertisementschizophreniaschizophrenicinexperienceddocumentationcorrespondentfundamentallyconscientiousindependentlycomprehensionindispensablecomprehensivecondescendingdifferentiatereinforcementcomplimentarystrengtheningschadenfreudeventriloquistparliamentaryinadvertentlycircumferencetemperamental
...View all with 13 letters...
Phrases (1222)
genus blaberusgenus struthiomight-have-beenauditory sensepar excellencefull treatmentgenus vanellusgenus glossinaslide fastenerburden of proof
...View all with 13 letters...
Words (1725)
representativeidentificationdisappointmentrecommendationsuperintendentrepresentationcorrespondencescientificallyaccomplishmentunderstatementunconventionalfundamentalistcoincidentallyimplementationdisorientationinconveniencedapprenticeshipsentimentalityaggressivenesshypersensitivehallucinogenicintentionalitycytogeneticistvindictivenesscomprehensibleaforementionedincompletenessquintessentialtranscendentalexistentialismschoolchildrenconfidentiallyintelligentsiapermissivenessprotectiveness
...View all with 14 letters...
Phrases (1306)
leave of absencegenus pelecanusexpense accountgarageman's lienprivate citizengenus blattellaclementine treefield intensitygenus sarcoptestheodor mommsen
...View all with 14 letters...
Words (1274)
confidentialityexperimentationunintentionallyacknowledgementenvironmentallyentrepreneurialdisenfranchisedinconsequentialdisillusionmentspermatogenesisdifferentiationmisapprehensionparthenogenesisconscientiouslylymphadenopathydesensitizationbioluminescencecompetitivenessdestructivenessdevelopmentallyinconveniencingdifferentiatinginstrumentationparentheticallyplenipotentiarypretentiousnessappropriatenesscondescendinglygastroenteritisinterventionistinquisitivenesstrinitrotolueneinstrumentalityenfranchisementacquisitiveness
...View all with 15 letters...
Phrases (1234)
centaurea cyanusbenefit of clergypresident hooverbusiness expensehigh renaissancealimentary pastehelen wills moodyperfective tenseebony spleenwortgenus potentilla
...View all with 15 letters...
Words (528)
incomprehensibleenthusiasticallyintercontinentalenvironmentalisttranscontinentalunderdevelopmentincomprehensiblyenvironmentalismmultidimensionalcounteroffensivepseudoscientifictriphenylmethanerepresentationalhyperintelligenthyperventilationentrepreneurshipundernourishmentquintessentiallyphylogeneticallyunreasonablenessdenaturalizationintraventricularovercompensationostentatiousnessinterventricularepiphenomenalismthrombocytopeniaabsentmindednessteleconferencingfundamentalisticdendrochronologyhypersensitivityoverenthusiasticsensationalisticcompartmentalize
...View all with 16 letters...
Phrases (1090)
multiengine planegenus utriculariamanihot esculentagenus crassostreagenus elaeocarpusgenus angiopterispresident johnsonchristian huygensbill of indictmentto a greater extent
...View all with 16 letters...
Words (312)
counterinsurgencyintergovernmentalmisidentificationunconventionalitytranscendentalismmisrepresentationconscientiousnesscompartmentalizedperchloroethylenechemiluminescencecomprehensivenessinconsequentiallytranscendentalistcompartmentalisedinappropriatenessuncomfortablenessnondenominationalinterdepartmentalknowledgeablenesscounterscientificsuperintelligenceantischizophreniairrevocablenessesantischizophreniccounterstatementsmiscomprehensionsthermoluminescentcomfortablenessesinflammablenessesleukoencephalitisinformativenessesunobtrusivenessesprivate-enterpriseobjectionablenessdisestablishments
...View all with 17 letters...
Phrases (906)
larix occidentalismount godwin austencompetence hearinggenus globicephalamount kanchenjungalandscape gardenergenus ceratosaurusbalaena mysticetusclomiphene citrateproteolytic enzyme
...View all with 17 letters...
Words (168)
compartmentalizinginconsequentialitygastroenterologistdisenfranchisementoverrepresentationinexpugnablenessesthermoluminescenceunintelligiblenesshypersensitivenesshypersensitivitieshypersensitizationcommensurabilitiesmisidentificationsnoncomprehensivelymisrepresentationsradiosensitivitiesinhospitablenessesdishonorablenessescommunicablenessesdisingenuousnessesunprofitablenessesappreciativenessesunreasonablenessesapprehensivenessesunresponsivenessescompartmentalisingpostmillenarianismhyposensitizationsunseasonablenessespentachlorophenolspentylenetetrazolspostmillennialismsanthropocentricitynonrepresentativespostmillennialists
...View all with 18 letters...
Phrases (689)
hindu calendar monthbusiness enterprisewashington monumentgenus struthiomimusdrafting instrumentpresident jeffersongenus styracosaurusjohn orley allen taterenaissance revivalmember of parliament
...View all with 18 letters...
Words (117)
counterintelligencecountertransferenceelectroluminescencepneumoencephalogramthermoluminescencesdisenfranchisementshypersensitizationsknowledgeablenessesunpretentiousnessesultracentrifugationnonproductivenessescommunicativenessesparthenogeneticallycompanionablenessessplendiferousnessesdispassionatenessespostmillenarianismsunconscientiousnesscompassionatenessesencephalomeningitiscomplementarinessescomprehensibilitiescomprehensivenessescytodifferentiationauthoritativenessescytopathogenicitiesimmunofluorescencesobjectionablenessesconscientiousnessesphenomenalisticallyconsequentialnessesgastroenterologicalgastroenterologistsgedankenexperimentsaccommodativenesses
...View all with 19 letters...
Phrases (484)
measuring instrumentaquilegia canadensissierra madre orientalseventeen-year locusthydrastis canadensisallium schoenoprasumcollective agreementread between the linesbarren ground cariboupierre-auguste renoir
...View all with 19 letters...
Words (54)
compartmentalizationoverenthusiasticallyelectroencephalogramparadichlorobenzenesunintelligiblenesseshypersensitivenessespolyphiloprogenitivecountertransferencesunrepresentativenesshyperadrenocorticismcomprehensiblenessescytodifferentiationsphenylpropanolaminesphenylthiocarbamidesphiloprogenitivenessneuroendocrinologiesneuroendocrinologistadrenocorticosteroidadrenocorticotropinsphosphoenolpyruvateselectroluminescencesrepresentationalismsrepresentationalistsbuckminsterfullerenerepresentativenessesadrenocorticotrophicultracentrifugationsadrenocorticotrophinconventionalizationsinappreciativenessesanthropocentricitiesdepartmentalizationsincommensurabilitiesincomprehensiblenessoverdifferentiations
...View all with 20 letters...
Phrases (429)
sweet-scented geraniumcalendula officinalisappendicular skeletonpara aminobenzoic acidpast progressive tenseevergreen bittersweetbalaenoptera physalusdouble-reed instrumentdevelopmental anatomyrobert louis stevenson
...View all with 20 letters...
Words (21)
electroencephalographdisestablishmentariancompartmentalizationsmultidimensionalitiesestablishmentarianismalkylbenzenesulfonateinterchangeablenessesneuroendocrinologicalneuroendocrinologistselectroencephalogramsadrenocorticosteroidsadrenocorticotrophinsmeningoencephalitidesbuckminsterfullerenesdendrochronologicallyincomprehensibilitiesarenaria-melanocephalanondenominationalismsundemonstrativenessesindistinguishablenessunexceptionablenessesPhrases (316)
acrocentric chromosomesierra madre occidentalabelmoschus esculentuselimination tournamentdirect electric currentexperimental conditionelectrolytic condenseraleksandr solzhenitsynexecution of instrumentspontaneous generation
...View all with 21 letters...
Words (13)
pentamethylenetetrazoldisestablishmentariansunrepresentativenessesnonrepresentationalismphiloprogenitivenessesintercomprehensibilityelectroencephalographselectroencephalographyhexamethylenetetramineincomprehensiblenessesencephalomyocarditisesdihydroxyphenylalanineestablishmentarianismsPhrases (256)
venezuelan monetary unitlycopersicon esculentumgregorian calendar monthtransient global amnesiaredevelopment authoritynavigational instrumentaleksandr i. solzhenitsynsir laurence kerr olivierviola tricolor hortensisinstrument of punishment
...View all with 22 letters...
Words (6)
electroencephalographicnonrepresentationalismselectroencephalographerpolytetrafluoroethylenehexamethylenetetraminesindistinguishablenessesPhrases (169)
parenthetical expressiontransient ischemic attackchlorpheniramine maleateto all intents and purposessubpoena ad testificandumyellowstone national parkcalycanthus occidentalisgenus pseudopleuronecteshippoglossus stenolepsisapium graveolens rapaceum
...View all with 23 letters...
Words (3)
intercomprehensibilitieselectroencephalographerselectroencephalographiesPhrases (132)
pelham grenville wodehouseargyroxiphium sandwicenseunidentified flying objectsir terence mervyn rattiganfrancois auguste rene rodindmitri ivanovich mendeleevcucumis melo cantalupensisinternal-combustion engineexistentialist philosophyardennes counteroffensive
...View all with 24 letters...
Words (1)
antiestablishmentarianismPhrases (111)
cluster of differentiation 4balaenoptera acutorostratachemical weapons conventioncruel and unusual punishmentnational science foundationcentral intelligence agencypropoxyphene hydrochloridesecret intelligence serviceamerican baptist conventionreligious society of friends
...View all with 25 letters...
Phrases (70)
helen maria fiske hunt jacksonright atrioventricular valvepolicing and enforcement costlassen volcanic national parkadrenocorticotropic hormonehuman immunodeficiency virusdepartment of transportationunited nations children's fundus government printing officeparthenocissus quinquefolia
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (47)
business environment analysispartial differential equationoffice of management and budgetsolenostemon scutellarioidesbeta-adrenergic blocking agentelectronic musical instrumentadrenocorticotrophic hormonedeoxyadenosine monophosphatesocial development commissioncryptobranchus alleganiensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (44)
aleksandr feodorovich kerenskybusiness process reengineeringbureau of engraving and printingephippiorhynchus senegalensistriphosphopyridine nucleotidecommission on the status of womencapital of serbia and montenegroludwig josef johan wittgensteindepartment of homeland securitygrace ethel cecile rosalie allen
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (34)
business environmental analysisacrylonitrile-butadiene-styrenedisorganized type schizophreniasouth-central dravidian languageferdinand joseph la menthe mortonhydrangea macrophylla hortensispresident william henry harrisonexecutive office of the presidentrene antoine ferchault de reaumurnational intelligence community
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (31)
valentina vladmirovna tereshkovaalexander isayevich solzhenitsynself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencecoluber constrictor flaviventrisethylenediaminetetraacetic acidbalance of international paymentsmultiple correlation coefficientwaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (28)
bureau of intelligence and researchunited states department of defensetupac amaru revolutionary movementunited states trade representativeposterior vein of the left ventriclegeorges eugene benjamin clemenceauislamic jihad movement in palestinerank-order correlation coefficientpremature ventricular contractionfrancoise-athenais de rochechouart
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (18)
african american vernacular englishpatent and trademark office databasedepartment of the federal governmentintercontinental ballistic missileobject-oriented programing languagecount nikolaus ludwig von zinzendorfinsulin-dependent diabetes mellituslymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoindependent state of papua new guinea
...View all with 32 letters...
Phrases (21)
musical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentstandard generalized markup languagelycopersicon esculentum cerasiformeobject-oriented programming languageelizabeth cleghorn stevenson gaskellgeneral agreement on tariffs and tradesir winston leonard spenser churchillfinancial crimes enforcement network
...View all with 33 letters...
Phrases (15)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationacademy of television arts and scienceskolmogorov's strong law of large numberseuropean law enforcement organisationvena centralis glandulae suprarenalisclostridium perfringens epsilon toxinfour-stroke internal-combustion enginedepartment of health and human services
...View all with 34 letters...
Phrases (16)
communications security establishmentinternational development associationtadeusz andrzej bonawentura kosciuszkocomte donatien alphonse francois de sadecanadian security intelligence servicemaxmillien marie isidore de robespierrehereditary motor and sensory neuropathyquintus septimius florens tertullianusfederal law enforcement training centerdepartment of defense laboratory system
...View all with 35 letters...
Phrases (14)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtnational geospatial-intelligence agencyfield-sequential color television systemfreedom from cruel and unusual punishmentcriminal intelligence services of canada
...View all with 36 letters...
Phrases (12)
severe combined immunodeficiency diseaseunited states declaration of independenceattention deficit hyperactivity disordercentre for international crime preventiongenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencesdepartment of health education and welfarekarl friedrich hieronymus von munchhausen
...View all with 37 letters...
