Words Containing: EDI
(In Exact Order)
There are 1,366 words,
628 phrases and
0 abbr's with
EDI in.
Best Scoring Words With: EDI
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| bedizen | 7 | 19 | verbv | |||||
verb • decorate tastelessly • dress up garishly and tastelessly | ||||||||
| khedive | 7 | 18 | noun, adjectiven, adj | |||||
noun • one of the Turkish viceroys who ruled Egypt between 1867 and 1914 | ||||||||
| medicks | 7 | 16 | nounn | |||||
noun • any of several Old World herbs of the genus Medicago having small flowers and trifoliate compound leaves | ||||||||
| medivac | 7 | 15 | verb, nounv, n | |||||
noun • the evacuation of persons (usually by air transportation) to a place where they can receive medical care | ||||||||
| medick | 6 | 15 | ||||||
noun • any of several Old World herbs of the genus Medicago having small flowers and trifoliate compound leaves | ||||||||
| editrix | 7 | 15 | nounn | |||||
noun • A female editor. | ||||||||
| mediacy | 7 | 15 | nounn | |||||
noun • the quality of being mediate | ||||||||
| comedic | 7 | 14 | adjectiveadj | |||||
adjective • Relating to comedy. | ||||||||
| bedight | 7 | 14 | verb, adjectivev, adj | |||||
verb • decorate | ||||||||
| reedify | 7 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (90)
medicalfeedingswedisheditingeditionpredictsubeditcreditstediousmediumsoedipusmediateedificecomedicoedipalkhedivemedivacedifiedreedingediblesbedightpedicelpediclebedizenseedingneedilysuedingdeedingreedilyedictalheedingedifiesineditatediumsaediles
...View all with 7 letters...
Phrases (2)
edit outsine dieWords (138)
medicinebleedingcomedianbreedingdedicatespeedingmedievalbenedictobedientmeredithcrediblemediocremeditatepedigreeredirectsedimentrecedingmedicarecreditedmediatorpedicurebenedickexpeditemedicateinedibleseditionheredityimpedingremedialmedicaidcreditoruneditedcrediblymediallyremedied
...View all with 8 letters...
Phrases (4)
closed innose diveside dishvia mediaWords (195)
immediatededicatedobedienceeditorialparamedicmedicinalmedicallyedinburghmedicateddiscreditprecedingexceedingmeditatedexpeditermediaevalpediatricayurvedictediouslyexpedientmediationneedinessmujahedinpredicatepredictorexpeditedmediatingimmediacypedigreedgreediestpredigestconcedingseditiousedibilitymeditatorseediness
...View all with 9 letters...
Phrases (14)
tax creditedith piafedible nutmedia gurubrake diskedible fatart editorhot mediumipse dixithouse dick
...View all with 9 letters...
Words (219)
incredibleincrediblymedicationexpeditiondedicationmeditationpredictioningredientproceedinghereditarymeditatingsucceedingmediocrityrediscoverimpedimentdedicatingmultimediaorthopedicmeditativemedicatingpediatricsinbreedingpredictivepredicatedstampedingaccreditedobedientlybenedictuscomediennebiomedicalpedicuristgreedinesspaediatricrededicatecreditable
...View all with 10 letters...
Phrases (33)
edible seedmedical mandrenched inoedipus rexcopy editoredible beanprint mediaects creditedible cornmedical aid
...View all with 10 letters...
Words (231)
immediatelypredictablecredibilityproceedingspredicamentexceedinglydiscreditedgravediggerdisobedientpredisposedsedimentarybenedictionpredictablyunmedicatedvaledictoryexpedientlyorthopedicsedificationmaledictionmediastinalmediastinumtediousnesspaediatricsrediscoveryimpedimentaorthopedistrededicatedorthopaedicpredicationexpeditiousmedievalismparamedicalmedicinablesupersedingcomedically
...View all with 11 letters...
Phrases (36)
text editionstage directmedium steelfilm editingphoto creditmedical billmedical exambearded iriscote d'ivoirecopy editing
...View all with 11 letters...
Words (153)
encyclopediapediatricianpremeditateddisobedienceintermediateintermediaryrededicationredistributepredilectionantediluvianeditorialiseorthopaedicsencyclopediceditorializerededicatingirremediablecreditworthyeditorialisthereditarilyorthopedistsrediscoveredmedievalistsbiomedicinesreaccreditedpremeditatordiscreditingaccreditableexpedienciesrediscussingredistrictedmaledictionspredicamentsbedizenmentsbenedictionsintermediacy
...View all with 12 letters...
Phrases (34)
thomas edisonmedieval modecitrus medicacourse creditedible cockletrade editionedith whartonedible bananakakke diseaselake district
...View all with 12 letters...
Words (130)
unpredictablemediterraneanvaledictorianpremeditationexpeditionarycrossbreedingencyclopaediapaediatricianaccreditationsedimentationredistributedexpeditiouslyinterbreedingeditorializeddiscreditableintermediatorunpredictablyencyclopaediccreditabilityimmediatenessruggedizationdiscreditablyencyclopedistredispositionnonaccreditedpremeditativerediscoveringvaledictoriesmedicamentousreaccreditingencyclopediaspredilectionspremeditatingpremeditatorsrededications
...View all with 13 letters...
Phrases (56)
removable diskcarved in stonerolled into onebabe didriksonmateria medicableeding heartbreast feedingdandie dinmontmedieval greektrade discount
...View all with 13 letters...
Words (78)
unpremeditatedredistributionpredispositionpredictabilityintermediarieseditorializingintermediatelyorthopedicallyredistributingmeditativenessredispositionssedimentationsredintegratingcreditablenessaccreditationspremeditationsredistributiveintermediatingpremeditatedlyrediscountableencyclopedismsinexpedienciessedimentologicvaledictoriansredintegrativeruggedizationsurediniosporesencyclopedistsintermediaciesovermedicatingunpredictablesbioremediationincrediblenessencyclopaediasredistillation
...View all with 14 letters...
Phrases (62)
stage directionlimited editionbenedict arnoldspeeding ticketdivina commediamedicago sativaswedish massagevoltage dividerstellaria mediagenus medinilla
...View all with 14 letters...
Words (32)
expeditiousnesspredispositionsimmediatenessessedimentologistreaccreditationincredibilitiesintermediationscreditabilitiesdedifferentiatesedimentologiesbioremediationsredistributionsremediabilitiesredistillationsnonsedimentableredintegrationsovermedicationsseditiousnessespredicabilitiesmedicalisationsencyclopaediststorpediniformeshereditarianismincrossbreedingautoschediasticautoschediazingimmedicablenessunpremeditationhereditarianistmedicalizationsencyclopaedismspredictablenessPhrases (59)
ethanedioic acidbroadcast mediummedical dressingcampanula mediumoctanedioic acidionic medicationschedule feedingmedicare paymentmedia consultantmedium frequency
...View all with 15 letters...
Words (18)
unpredictabilitycreditablenessessedimentologistsirremediablenessencyclopedicallyincrediblenessesdedifferentiatedpredictabilitiesreaccreditationsthree-dimensionaldedifferentiatessedimentologicalintermediatenessmeditativenessesredistributionaleditorializationcreditworthinesspodicipediformesPhrases (65)
commedia dell'artedispersing mediummedical scientistcnicus benedictuspediculosis pubisgiving medicationpediculus humanusalluvial sedimentsealed instrumentmedical prognosis
...View all with 16 letters...
Words (8)
redistributionisteditorializationsexpeditiousnessesdisintermediationdedifferentiationsamoyedic-speakingdedifferentiatingone-dimensionalityPhrases (50)
undivided intereststreet credibilitypediculus corporisfeast of dedicationmedical evacuationmedieval schoolmangenus selenipediumunbounded intervalmedical specialisthereditary pattern
...View all with 17 letters...
Words (8)
dedifferentiationscreditworthinessesredistributionistsunpredictabilitiesirremediablenessesdisintermediationssedimentologicallyintermediatenessesPhrases (48)
swedish nightingalefree-reed instrumentstringed instrumentbachelor of medicinemilitary expeditionsuborder pinnipediaurogenital medicinetemporary expedientvaledictory addressgenus phragmipedium
...View all with 18 letters...
Phrases (1)
hereditary motor and sensory neuropathyPhrases (1)
enzyme-linked-immunosorbent serologic assayPhrases (1)
nicotinamide adenine dinucleotide phosphate
