Words Containing: E,Y,I,S,H
(In Any Order)
There are 2,311 words,
1,674 phrases and
0 abbr's with
E,Y,I,S,H in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
whiskey | 7 | 20 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
wheyish | 7 | 19 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
hickeys | 7 | 19 | verb, nounv, n | |||||
noun • a small inflamed elevation of the skin; a pustule or papule; common symptom in acne • a temporary red mark on a person's skin resulting from kissing or sucking by their lover | ||||||||
whimsey | 7 | 18 | nounn | |||||
noun • an odd or fanciful or capricious idea • the trait of acting unpredictably and more from whim or caprice than from reason or judgment | ||||||||
shrieky | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
fishery | 7 | 16 | nounn | |||||
noun • a workplace where fish are caught and processed and sold | ||||||||
yeshiva | 7 | 16 | noun, adjectiven, adj | |||||
noun • an academy for the advanced study of Jewish texts (primarily the Talmud) | ||||||||
shivery | 7 | 16 | adjectiveadj | |||||
adjective satellite • cold enough to cause shivers • provoking fear or terror | ||||||||
fisheye | 7 | 16 | noun, adjectiven, adj | |||||
adjective • of or relating to a fisheye lens | ||||||||
whiteys | 7 | 16 | nounn | |||||
noun • (slang) offensive names for a White man | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
eyeishWords (70)
eyesighthysteriaphysiquehystericslitheryshimmerywhiskeryhyoscineyeshivahhyalinessmitheryyeshivaschimneysthymiestthyminesshinneryshinneysfleshilyelvishlyisohyetswhiskeyswhisperyhyalitesfisheyesyohimbeselfishlyhybrisesyokelishlehayimsmythiestchestilyfogeyishwhimseysnebbishylecythis
...View all with 8 letters...
Phrases (2)
by inchesshift keyWords (126)
chemistrysynthetichairstylejellyfishyorkshirehystericssynthesisselfishlyhygienisthideouslyhemolysisheinouslyyellowishhypnotisehellishlyhesitancysisypheanspeechifyhostilelyhemolysinstitcheryepiphysishygienicspeevishlysylphlikesypheringphysiquedphysiqueskaffiyehsmonkeyishhysteriashideositylechayimsepiphysesbiphenyls
...View all with 9 letters...
Phrases (8)
high stylehair stylesay hey kidthe skinnyeasy chairjewish ryerye whiskyship moneyWords (237)
hystericalhypothesissympathizestealthilydishonestyhieronymusstrychninesympathiseprehistoryfreakishlysynthesizesheepishlyhypnotisedasphyxiateecchymosisfeverishlydevilishlyfiendishlysynthesisemetaphysichypersonicpolytheismhypodermishemoptysispolytheistepiphysealepiphysialchrysolitehaemolysismyastheniahesitantlythucydidesgeophysicssphericitylyophilise
...View all with 10 letters...
Phrases (14)
basil thymehoney crispwhite daisyos hyoideumchinese yamenglish ivyenglish yewswedish ryeshoofly piedaisy wheel
...View all with 10 letters...
Words (323)
sympatheticpsychedelicsynchronizesynthesizermetaphysicssynesthesiasynthesizedasphyxiatedsympathizersphericallypsychedeliadishonestlygeophysicalmonkeyshinehypotensivesynchronisesympathiserhypothesizesympathisedrighteouslyunselfishlyhyperemesishousewifelyhousewiferysqueamishlyhypotensionhyperplasiayesternightsynthesiserpsychogenicvichyssoisesemimonthlylyophilisedfaithlesslymisshapenly
...View all with 11 letters...
Phrases (24)
mighty mousesensory hairanise hyssopwhiskey neatwhiskey sourwhistle buoyship's galleyhigh societyholy thistlefisheye lens
...View all with 11 letters...
Words (362)
synchronizedmetaphysicalhystericallybiochemistrybiosynthesishypertensionrefreshinglyhypertensivepyrotechnicssynchronisedpraiseworthypsychoactivehypothesizedsuperhighwayexhaustivelygeophysicistpsychometrichypnotisableweightlesslypsychologizesynthesizingsynaesthesiaestheticallysynchronizersolzhenitsynhesitatinglycoquettishlyphysicalnessbeseechinglybiosynthetichyperintensefarsightedlyblithesomelyhyperkineseshyperkinesia
...View all with 12 letters...
Phrases (36)
chinese deityphantasy lifestring theorymass hysteriabobby fischersir fred hoylesir henry woodholy of holiesasthenic typewhite cypress
...View all with 12 letters...
Words (312)
homosexualityhieroglyphicsphysiotherapyhyperhidrosisunsympatheticaestheticallycholecystitisneurosyphilissyntheticallyphysostigminehypothesisinghydrosulphidepsychokinetichypothesizingmischievouslypsychokinesisinexhaustiblyperishabilitypsychogenetichyaluronidaseholidaymakersthymectomizeshyperhidrosesstylishnessestheophyllinesdysmenorrheiclymphadenitishypocalcemiasphysiographerpolicyholdersunrighteouslyforesightedlypolycythemiasgeophysicallygeophysicists
...View all with 13 letters...
Phrases (70)
harvey cushingel iskandriyahmexican hyssopthree kings' daymyles standishhenry steinwaywhiskey bottlevachel lindsayholy eucharistjunco hyemalis
...View all with 13 letters...
Words (301)
hypersensitivephotosynthesisthermodynamicschemosynthesispsychoneuroticmetaphysicallymetempsychosisnarcosynthesismicrochemistryunsynchronizedpyelonephritisdemythologisedpsychoneurosisphotosynthetichydrotherapistchemosynthetichydrocortisoneanesthesiologyunhesitatinglypraiseworthilystretchabilitycomprehensiblythyrotoxicosesgeohydrologistheterozygosityaminophyllineshypermasculinehypermetropiashypercriticismmetaphysicianspyrimethamineshedonisticallyhyperrealistichypersensitizecosmochemistry
...View all with 14 letters...
Phrases (94)
yellowish brownblended whiskeychinese parsleychristopher frygenus nymphicushenry cavendishsouth yorkshiredeciduous hollyhenry kissingerartillery shell
...View all with 14 letters...
Words (247)
psychotherapistanaesthesiologyphysiotherapistheterosexualitysympathomimeticsuccinylcholineneurophysiologystereochemistryphotosynthesizesympatheticallyeuphemisticallyneuropsychiatrycomprehensivelyimperishabilitykinestheticallyadenohypophysishypersensitizedneurohypophysisthyroidectomiespsychedelicallymethylxanthinespolysaccharidesdisenchantinglydishearteninglyhyperaggressivehypersalivationpsychometriciancyproheptadinespsychosynthesishyperstimulatedhyperstimulatespsychotomimeticsophisticatedlyhypervigilanceshyposensitizing
...View all with 15 letters...
Phrases (125)
helen wills moodydialysis machinesystem of weightspsychotic beliefsodium hydroxidehyoscyamus nigerspiny-headed wormarachis hypogaeajemaah islamiyahmythical monster
...View all with 15 letters...
Words (112)
enthusiasticallyincomprehensiblyerythroblastosisthermostaticallyelectrochemistryhypersensitivityneuropsychiatrichypersalivationsinextinguishablyhypersensitizinghypersexualitiesinexhaustibilitythermoplasticityhyperstimulatinghyperstimulationparapsychologieshypersusceptibleparasympatheticshyperthyroidismshyperviscositieshypervitaminoseshypophysectomiesmonotheisticallyarchiepiscopallyhypophysectomiseleukodystrophieshypophysectomizestenographicallyephippiorhynchusstereophonicallyphotosensitivitycyanoethylationscyclohexylaminesperiphrasticallycyclophosphamide
...View all with 16 letters...
Phrases (133)
christian huygenschemical analysisnevil shute norwaymechanical systempharyngeal tonsilrheims-douay biblereligious holidayelwyn brooks whitethysanuran insectsuper heavyweight
...View all with 16 letters...
Words (63)
neurophysiologistpsychotherapeutichyperreactivitiesphysiotherapeuticspondylolisthesishyperstimulationshyperventilationshypnotizabilitiesthrombocytopeniashypophysectomizespathophysiologieshyposensitizationhypophysectomisedhypophysectomizedencephalomyelitiscrystallographieslymphadenopathiescyclophosphamidescytotechnologistsphenylethylaminesdehydrochlorinaseorthopsychiatriestriiodothyroninestriphenylmethanesneurophysiologiesneuropsychiatriesneuropsychiatristneuropsychologiesneuropsychologistunsympatheticallymetapsychologicalsuperheavyweightsdesynchronisationdesynchronizationcomprehensibility
...View all with 17 letters...
Phrases (147)
salvia leucophyllainterstate highwaytheological systemprimary censorshippetasites hybriduspython reticulatushexadecimal systemgenus dactylorhizaegyptian paper rushrosebay willowherb
...View all with 17 letters...
Words (56)
characteristicallyhyperaldosteronismneuropsychologicalhypersensitivenesshypersensitivitieshypersensitizationspectroheliographynoncomprehensivelypsychotherapeuticssphygmomanometrieshypophysectomizinghyposensitizationslipopolysaccharidetriphosphopyridinelymphangiographiesstoichiometricallypteridospermaphytadiethylstilbestrolmucopolysaccharidehypercholesteremiadehydrochlorinasesdehydrochlorinatestrichloroethylenesspectrographicallyaerothermodynamicsneurophysiologistsneuropsychiatristselectromyographiesneuropsychologistsdemythologizationselectrophysiologicmethylprednisolonedephosphorylationshomobasidiomyceteschlortetracyclines
...View all with 18 letters...
Phrases (149)
family physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyclass schizomycetesantipsychotic agentgenus chamaecytisusshort-term liabilityarchitectural stylearthur garfield hays
...View all with 18 letters...
Words (37)
hyperparathyroidismhypersensitizationshypersusceptibilityparathyroidectomiesmucopolysaccharideslipopolysaccharidescytopathogenicitiesimmunocytochemistrydiethylstilbesteroldiethylstilboestrolphenomenalisticallyphosphatidylcholinethird-dimensionalityhysterosalpingogramthree-dimensionalitymethylprednisoloneselectrophysiologieselectrophysiologistincomprehensibilityencephalomyelitidesdihydrostreptomycinhydrometeorologistsparasympathomimeticdiethylcarbamazinesdiethylstilbestrolsphytohemagglutininshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminepsychotomimeticallyhyperemotionalitiesdimethyltryptamineshyperexcitabilitiesexhibitionistically
...View all with 19 letters...
Phrases (151)
building supply housejohn millington syngehydrastis canadensisgiles lytton stracheygenus symphoricarposavogadro's hypothesischinese monetary unithydrobates pelagicusuniversity of chicagosymphytum officinale
...View all with 19 letters...
Words (28)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyhypersensitivenesseshyperadrenocorticismbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicselectrophysiologicalelectrophysiologistsimmunohistochemistryencephalomyocarditishydrochlorothiazidespsychopharmacologieshypercholesterolemichypercoagulabilitieshyperconsciousnessesdimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsPhrases (129)
yellow-shafted flickerwyethia amplexicaulisdivision tracheophytabalance sheet analysismechanically skillfulmilton snavely hersheyfriendly relationshipsouth american countryclaude achille debussyluscinia megarhynchos
...View all with 20 letters...
Words (7)
hypersusceptibilitiesimmunocytochemistriesacetylcholinesterasesotorhinolaryngologieshypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (112)
aleksandr solzhenitsynhelichrysum bracteatumparty to the transactionstrawberry haemangiomaptolemy ii philadelphushenry hobson richardsonagricultural chemistryspeech intelligibilityhans holbein the youngersyngnathus hildebrandi
...View all with 21 letters...
Words (5)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (104)
haliaeetus leucorhyphusaleksandr i. solzhenitsynsodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroidesfamily branchiostomidaeatmospheric electricitysphyrapicus varius ruberjohns hopkins university
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (72)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphytasearch and destroy mission
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (59)
argyroxiphium sandwicensedivision heterokontophytaprimary sex characteristicdistinguished flying crossexistentialist philosophytechnology administrationhypersensitivity reactionsir charles leonard woolleychrysosplenium americanumoxidative phosphorylation
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (48)
modest petrovich mussorgskyedmund john millington syngepolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidessir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovskysudden infant death syndromeanthony charles lynton blair
...View all with 25 letters...
Phrases (38)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Phrases (36)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (27)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoy
...View all with 28 letters...
Phrases (14)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromehenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsfamily schizosaccharomycetaceaeprovisional irish republican army
...View all with 30 letters...
Phrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (1)
respiratory distress syndrome of the newborn